dinaciclib [Ligand Id: 7379] activity data from GtoPdb and ChEMBL

Click here for a description of the charts and data table

Please tell us if you are using this feature and what you think!

ChEMBL ligand: CHEMBL2103840 (Dinaciclib, Mk-7965, SCH 727965, SCH-727965, SCH727965)
There should be some charts here, you may need to enable JavaScript!
  • protein kinase AMP-activated catalytic subunit alpha 1/5`-AMP-activated protein kinase catalytic subunit alpha-1 in Human [ChEMBL: CHEMBL4045] [GtoPdb: 1541] [UniProtKB: Q13131]
There should be some charts here, you may need to enable JavaScript!
  • protein kinase AMP-activated non-catalytic subunit gamma 1/5`-AMP-activated protein kinase subunit gamma-1 in Human [ChEMBL: CHEMBL2393] [GtoPdb: 1545] [UniProtKB: P54619]
There should be some charts here, you may need to enable JavaScript!
  • protein kinase AMP-activated non-catalytic subunit gamma 2/5`-AMP-activated protein kinase subunit gamma-2 in Human [ChEMBL: CHEMBL2453] [GtoPdb: 1546] [UniProtKB: Q9UGJ0]
There should be some charts here, you may need to enable JavaScript!
  • aarF domain containing kinase 1/AarF domain-containing protein kinase 1 in Human [ChEMBL: CHEMBL4105885] [GtoPdb: 1925] [UniProtKB: Q86TW2]
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
  • tyrosine kinase non receptor 2/Activated CDC42 kinase 1 in Human [ChEMBL: CHEMBL4599] [GtoPdb: 2246] [UniProtKB: Q07912]
There should be some charts here, you may need to enable JavaScript!
  • activin A receptor type 1/Activin receptor type-1 in Human [ChEMBL: CHEMBL5903] [GtoPdb: 1785] [UniProtKB: Q04771]
There should be some charts here, you may need to enable JavaScript!
  • activin A receptor type 1B/Activin receptor type-1B in Human [ChEMBL: CHEMBL5310] [GtoPdb: 1787] [UniProtKB: P36896]
There should be some charts here, you may need to enable JavaScript!
  • activin A receptor type 2B/Activin receptor type-2B in Human [ChEMBL: CHEMBL5466] [GtoPdb: 1792] [UniProtKB: Q13705]
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
  • Adenylate kinase 2, mitochondrial in Human [ChEMBL: CHEMBL4938] [UniProtKB: P54819]
There should be some charts here, you may need to enable JavaScript!
  • Mitochondrial adenine nucleotide translocator 2/ADP/ATP translocase 2 in Human [ChEMBL: CHEMBL3709670] [GtoPdb: 1063] [UniProtKB: P05141]
There should be some charts here, you may need to enable JavaScript!
  • Mitochondrial adenine nucleotide translocator 3/ADP/ATP translocase 3 in Human [ChEMBL: CHEMBL4105854] [GtoPdb: 1064] [UniProtKB: P12236]
There should be some charts here, you may need to enable JavaScript!
  • AKR1C3/Aldo-keto reductase family 1 member C3 in Human [ChEMBL: CHEMBL4681] [GtoPdb: 1382] [UniProtKB: P42330]
There should be some charts here, you may need to enable JavaScript!
  • AP2 associated kinase 1/AP2-associated protein kinase 1 in Human [ChEMBL: CHEMBL3830] [GtoPdb: 1921] [UniProtKB: Q2M2I8]
There should be some charts here, you may need to enable JavaScript!
  • ATP-dependent 6-phosphofructokinase, platelet type in Human [ChEMBL: CHEMBL2972] [UniProtKB: Q01813]
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
  • ATP-dependent RNA helicase DDX3X in Human [ChEMBL: CHEMBL5553] [UniProtKB: O00571]
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
  • coenzyme Q8A/Atypical kinase COQ8A, mitochondrial in Human [ChEMBL: CHEMBL5550] [GtoPdb: 1927] [UniProtKB: Q8NI60]
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
  • beta adrenergic receptor kinase 1/Beta-adrenergic receptor kinase 1 in Human [ChEMBL: CHEMBL4079] [GtoPdb: 1466] [UniProtKB: P25098]
There should be some charts here, you may need to enable JavaScript!
  • Bifunctional phosphoribosylaminoimidazole carboxylase/phosphoribosylaminoimidazole succinocarboxamide synthetase in Human [ChEMBL: CHEMBL5922] [UniProtKB: P22234]
There should be some charts here, you may need to enable JavaScript!
  • BMP2 inducible kinase/BMP-2-inducible protein kinase in Human [ChEMBL: CHEMBL4522] [GtoPdb: 1941] [UniProtKB: Q9NSY1]
There should be some charts here, you may need to enable JavaScript!
  • bone morphogenetic protein receptor type IA/Bone morphogenetic protein receptor type-1A in Human [ChEMBL: CHEMBL5275] [GtoPdb: 1786] [UniProtKB: P36894]
There should be some charts here, you may need to enable JavaScript!
  • bone morphogenetic protein receptor type IB/Bone morphogenetic protein receptor type-1B in Human [ChEMBL: CHEMBL5476] [GtoPdb: 1789] [UniProtKB: O00238]
There should be some charts here, you may need to enable JavaScript!
  • bone morphogenetic protein receptor type 2/Bone morphogenetic protein receptor type-2 in Human [ChEMBL: CHEMBL5467] [GtoPdb: 1794] [UniProtKB: Q13873]
There should be some charts here, you may need to enable JavaScript!
  • BCR activator of RhoGEF and GTPase/Breakpoint cluster region protein in Human [ChEMBL: CHEMBL5146] [GtoPdb: 2755] [UniProtKB: P11274]
There should be some charts here, you may need to enable JavaScript!
  • bromodomain containing 4/Bromodomain-containing protein 4 in Human [ChEMBL: CHEMBL1163125] [GtoPdb: 1945] [UniProtKB: O60885]
There should be some charts here, you may need to enable JavaScript!
  • bromodomain testis associated/Bromodomain testis-specific protein in Human [ChEMBL: CHEMBL1795185] [GtoPdb: 2729] [UniProtKB: Q58F21]
There should be some charts here, you may need to enable JavaScript!
  • calcium/calmodulin dependent protein kinase kinase 2/Calcium/calmodulin-dependent protein kinase kinase 2 in Human [ChEMBL: CHEMBL5284] [GtoPdb: 1957] [UniProtKB: Q96RR4]
There should be some charts here, you may need to enable JavaScript!
  • calcium/calmodulin-dependent protein kinase II delta subunit/Calcium/calmodulin-dependent protein kinase type II subunit delta in Human [ChEMBL: CHEMBL2801] [GtoPdb: 1558] [UniProtKB: Q13557]
There should be some charts here, you may need to enable JavaScript!
  • calcium/calmodulin-dependent protein kinase II gamma subunit/Calcium/calmodulin-dependent protein kinase type II subunit gamma in Human [ChEMBL: CHEMBL3829] [GtoPdb: 1557] [UniProtKB: Q13555]
There should be some charts here, you may need to enable JavaScript!
  • calcium/calmodulin dependent protein kinase IV/Calcium/calmodulin-dependent protein kinase type IV in Human [ChEMBL: CHEMBL2494] [GtoPdb: 1955] [UniProtKB: Q16566]
There should be some charts here, you may need to enable JavaScript!
  • protein kinase, cAMP-dependent, catalytic, alpha subunit/cAMP-dependent protein kinase catalytic subunit alpha in Human [ChEMBL: CHEMBL4101] [GtoPdb: 1476] [UniProtKB: P17612]
There should be some charts here, you may need to enable JavaScript!
  • protein kinase, cAMP-dependent, catalytic, beta subunit/cAMP-dependent protein kinase catalytic subunit beta in Human [ChEMBL: CHEMBL2918] [GtoPdb: 1477] [UniProtKB: P22694]
There should be some charts here, you may need to enable JavaScript!
  • protein kinase, cAMP-dependent, catalytic, gamma subunit/cAMP-dependent protein kinase catalytic subunit gamma in Human [ChEMBL: CHEMBL2743] [GtoPdb: 1478] [UniProtKB: P22612]
There should be some charts here, you may need to enable JavaScript!
  • protein kinase, cAMP-dependent, regulatory, type II, alpha subunit/cAMP-dependent protein kinase type II-alpha regulatory subunit in Human [ChEMBL: CHEMBL2221] [GtoPdb: 1474] [UniProtKB: P13861]
There should be some charts here, you may need to enable JavaScript!
  • casein kinase 1 alpha 1/Casein kinase I isoform alpha in Human [ChEMBL: CHEMBL2793] [GtoPdb: 1995] [UniProtKB: P48729]
There should be some charts here, you may need to enable JavaScript!
  • casein kinase 1 delta/Casein kinase I isoform delta in Human [ChEMBL: CHEMBL2828] [GtoPdb: 1997] [UniProtKB: P48730]
There should be some charts here, you may need to enable JavaScript!
  • casein kinase 1 epsilon/Casein kinase I isoform epsilon in Human [ChEMBL: CHEMBL4937] [GtoPdb: 1998] [UniProtKB: P49674]
There should be some charts here, you may need to enable JavaScript!
  • casein kinase 1 gamma 1/Casein kinase I isoform gamma-1 in Human [ChEMBL: CHEMBL2426] [GtoPdb: 1999] [UniProtKB: Q9HCP0]
There should be some charts here, you may need to enable JavaScript!
  • casein kinase 1 gamma 2/Casein kinase I isoform gamma-2 in Human [ChEMBL: CHEMBL2543] [GtoPdb: 2000] [UniProtKB: P78368]
There should be some charts here, you may need to enable JavaScript!
  • casein kinase 1 gamma 3/Casein kinase I isoform gamma-3 in Human [ChEMBL: CHEMBL5084] [GtoPdb: 2001] [UniProtKB: Q9Y6M4]
There should be some charts here, you may need to enable JavaScript!
  • casein kinase 2, alpha prime polypeptide subunit/Casein kinase II subunit alpha` in Human [ChEMBL: CHEMBL4070] [GtoPdb: 1550] [UniProtKB: P19784]
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
  • Protein kinase G (PKG) 1/cGMP-dependent protein kinase 1 in Human [ChEMBL: CHEMBL4273] [GtoPdb: 1492] [UniProtKB: Q13976]
There should be some charts here, you may need to enable JavaScript!
  • Choline-phosphate cytidylyltransferase A in Human [ChEMBL: CHEMBL4105855] [UniProtKB: P49585]
There should be some charts here, you may need to enable JavaScript!
  • Chromodomain-helicase-DNA-binding protein 4 in Human [ChEMBL: CHEMBL4105742] [UniProtKB: Q14839]
There should be some charts here, you may need to enable JavaScript!
  • citron rho-interacting serine/threonine kinase/Citron Rho-interacting kinase in Human [ChEMBL: CHEMBL5579] [GtoPdb: 1509] [UniProtKB: O14578]
There should be some charts here, you may need to enable JavaScript!
  • cyclin dependent kinase 1/Cyclin-dependent kinase 1 in Human [ChEMBL: CHEMBL308] [GtoPdb: 1961] [UniProtKB: P06493]
There should be some charts here, you may need to enable JavaScript!
  • cyclin dependent kinase 12/Cyclin-dependent kinase 12 in Human [ChEMBL: CHEMBL3559692] [GtoPdb: 1965] [UniProtKB: Q9NYV4]
There should be some charts here, you may need to enable JavaScript!
  • cyclin dependent kinase 13/Cyclin-dependent kinase 13 in Human [ChEMBL: CHEMBL1795192] [GtoPdb: 1966] [UniProtKB: Q14004]
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
  • cyclin dependent kinase 16/Cyclin-dependent kinase 16 in Human [ChEMBL: CHEMBL4597] [GtoPdb: 1969] [UniProtKB: Q00536]
There should be some charts here, you may need to enable JavaScript!
  • cyclin dependent kinase 17/Cyclin-dependent kinase 17 in Human [ChEMBL: CHEMBL5790] [GtoPdb: 1970] [UniProtKB: Q00537]
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
  • cyclin dependent kinase 2/Cyclin-dependent kinase 2 in Human [ChEMBL: CHEMBL301] [GtoPdb: 1973] [UniProtKB: P24941]
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
  • cyclin dependent kinase 2/Cyclin-dependent kinase 2/G1/S-specific cyclin-D1 in Human [ChEMBL: CHEMBL3885552] [GtoPdb: 1973] [UniProtKB: P24385P24941]
There should be some charts here, you may need to enable JavaScript!
  • cyclin dependent kinase 3/Cyclin-dependent kinase 3 in Human [ChEMBL: CHEMBL4442] [GtoPdb: 1975] [UniProtKB: Q00526]
There should be some charts here, you may need to enable JavaScript!
  • cyclin dependent kinase 4/Cyclin-dependent kinase 4 in Human [ChEMBL: CHEMBL331] [GtoPdb: 1976] [UniProtKB: P11802]
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
  • cyclin dependent kinase 5/Cyclin-dependent kinase 5 in Human [ChEMBL: CHEMBL4036] [GtoPdb: 1977] [UniProtKB: Q00535]
There should be some charts here, you may need to enable JavaScript!
  • cyclin dependent kinase 5/Cyclin-dependent kinase 5/CDK5 activator 1 in Human [ChEMBL: CHEMBL1907600] [GtoPdb: 1977] [UniProtKB: Q00535Q15078]
There should be some charts here, you may need to enable JavaScript!
  • cyclin dependent kinase 6/Cyclin-dependent kinase 6 in Human [ChEMBL: CHEMBL2508] [GtoPdb: 1978] [UniProtKB: Q00534]
There should be some charts here, you may need to enable JavaScript!
  • cyclin dependent kinase 7/Cyclin-dependent kinase 7 in Human [ChEMBL: CHEMBL3055] [GtoPdb: 1979] [UniProtKB: P50613]
There should be some charts here, you may need to enable JavaScript!
  • cyclin dependent kinase 8/Cyclin-dependent kinase 8 in Human [ChEMBL: CHEMBL5719] [GtoPdb: 1980] [UniProtKB: P49336]
There should be some charts here, you may need to enable JavaScript!
  • cyclin dependent kinase 9/Cyclin-dependent kinase 9 in Human [ChEMBL: CHEMBL3116] [GtoPdb: 1981] [UniProtKB: P50750]
There should be some charts here, you may need to enable JavaScript!
  • cyclin-dependent kinase like 5/Cyclin-dependent kinase-like 5 in Human [ChEMBL: CHEMBL1163112] [GtoPdb: 1986] [UniProtKB: O76039]
There should be some charts here, you may need to enable JavaScript!
  • cyclin G associated kinase/Cyclin-G-associated kinase in Human [ChEMBL: CHEMBL4355] [GtoPdb: 2027] [UniProtKB: O14976]
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
  • Cytochrome c1, heme protein, mitochondrial in Human [ChEMBL: CHEMBL4105975] [UniProtKB: P08574]
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
  • discoidin domain receptor tyrosine kinase 2/Discoidin domain-containing receptor 2 in Human [ChEMBL: CHEMBL5122] [GtoPdb: 1844] [UniProtKB: Q16832]
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
  • DNA topoisomerase II alpha/DNA topoisomerase 2-alpha in Human [ChEMBL: CHEMBL1806] [GtoPdb: 2637] [UniProtKB: P11388]
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
  • mitogen-activated protein kinase kinase 1/Dual specificity mitogen-activated protein kinase kinase 1 in Human [ChEMBL: CHEMBL3587] [GtoPdb: 2062] [UniProtKB: Q02750]
There should be some charts here, you may need to enable JavaScript!
  • mitogen-activated protein kinase kinase 2/Dual specificity mitogen-activated protein kinase kinase 2 in Human [ChEMBL: CHEMBL2964] [GtoPdb: 2063] [UniProtKB: P36507]
There should be some charts here, you may need to enable JavaScript!
  • mitogen-activated protein kinase kinase 3/Dual specificity mitogen-activated protein kinase kinase 3 in Human [ChEMBL: CHEMBL2109] [GtoPdb: 2064] [UniProtKB: P46734]
There should be some charts here, you may need to enable JavaScript!
  • mitogen-activated protein kinase kinase 4/Dual specificity mitogen-activated protein kinase kinase 4 in Human [ChEMBL: CHEMBL2897] [GtoPdb: 2065] [UniProtKB: P45985]
There should be some charts here, you may need to enable JavaScript!
  • mitogen-activated protein kinase kinase 5/Dual specificity mitogen-activated protein kinase kinase 5 in Human [ChEMBL: CHEMBL4948] [GtoPdb: 2066] [UniProtKB: Q13163]
There should be some charts here, you may need to enable JavaScript!
  • mitogen-activated protein kinase kinase 6/Dual specificity mitogen-activated protein kinase kinase 6 in Human [ChEMBL: CHEMBL2171] [GtoPdb: 2067] [UniProtKB: P52564]
There should be some charts here, you may need to enable JavaScript!
  • CDC like kinase 1/Dual specificity protein kinase CLK1 in Human [ChEMBL: CHEMBL4224] [GtoPdb: 1990] [UniProtKB: P49759]
There should be some charts here, you may need to enable JavaScript!
  • CDC like kinase 2/Dual specificity protein kinase CLK2 in Human [ChEMBL: CHEMBL4225] [GtoPdb: 1991] [UniProtKB: P49760]
There should be some charts here, you may need to enable JavaScript!
  • CDC like kinase 4/Dual specificity protein kinase CLK4 in Human [ChEMBL: CHEMBL4203] [GtoPdb: 1993] [UniProtKB: Q9HAZ1]
There should be some charts here, you may need to enable JavaScript!
  • testis associated actin remodelling kinase 1/Dual specificity testis-specific protein kinase 1 in Human [ChEMBL: CHEMBL5604] [GtoPdb: 2239] [UniProtKB: Q15569]
There should be some charts here, you may need to enable JavaScript!
  • testis associated actin remodelling kinase 2/Dual specificity testis-specific protein kinase 2 in Human [ChEMBL: CHEMBL2069163] [GtoPdb: 2240] [UniProtKB: Q96S53]
There should be some charts here, you may need to enable JavaScript!
  • dual specificity tyrosine phosphorylation regulated kinase 1A/Dual specificity tyrosine-phosphorylation-regulated kinase 1A in Human [ChEMBL: CHEMBL2292] [GtoPdb: 2009] [UniProtKB: Q13627]
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
  • TP53 regulating kinase/EKC/KEOPS complex subunit TP53RK in Human [ChEMBL: CHEMBL1938223] [GtoPdb: 2248] [UniProtKB: Q96S44]
There should be some charts here, you may need to enable JavaScript!
  • Electron transfer flavoprotein subunit beta in Human [ChEMBL: CHEMBL4105744] [UniProtKB: P38117]
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
  • EPH receptor A1/Ephrin type-A receptor 1 in Human [ChEMBL: CHEMBL5810] [GtoPdb: 1821] [UniProtKB: P21709]
There should be some charts here, you may need to enable JavaScript!
  • EPH receptor A2/Ephrin type-A receptor 2 in Human [ChEMBL: CHEMBL2068] [GtoPdb: 1822] [UniProtKB: P29317]
There should be some charts here, you may need to enable JavaScript!
  • EPH receptor A4/Ephrin type-A receptor 4 in Human [ChEMBL: CHEMBL3988] [GtoPdb: 1824] [UniProtKB: P54764]
There should be some charts here, you may need to enable JavaScript!
  • EPH receptor A5/Ephrin type-A receptor 5 in Human [ChEMBL: CHEMBL3987] [GtoPdb: 1825] [UniProtKB: P54756]
There should be some charts here, you may need to enable JavaScript!
  • EPH receptor A7/Ephrin type-A receptor 7 in Human [ChEMBL: CHEMBL4602] [GtoPdb: 1827] [UniProtKB: Q15375]
There should be some charts here, you may need to enable JavaScript!
  • EPH receptor B2/Ephrin type-B receptor 2 in Human [ChEMBL: CHEMBL3290] [GtoPdb: 1831] [UniProtKB: P29323]
There should be some charts here, you may need to enable JavaScript!
  • EPH receptor B3/Ephrin type-B receptor 3 in Human [ChEMBL: CHEMBL4901] [GtoPdb: 1832] [UniProtKB: P54753]
There should be some charts here, you may need to enable JavaScript!
  • EPH receptor B4/Ephrin type-B receptor 4 in Human [ChEMBL: CHEMBL5147] [GtoPdb: 1833] [UniProtKB: P54760]
There should be some charts here, you may need to enable JavaScript!
  • EPH receptor B6/Ephrin type-B receptor 6 in Human [ChEMBL: CHEMBL5836] [GtoPdb: 1834] [UniProtKB: O15197]
There should be some charts here, you may need to enable JavaScript!
  • epidermal growth factor receptor/Epidermal growth factor receptor in Human [ChEMBL: CHEMBL203] [GtoPdb: 1797] [UniProtKB: P00533]
There should be some charts here, you may need to enable JavaScript!
  • discoidin domain receptor tyrosine kinase 1/Epithelial discoidin domain-containing receptor 1 in Human [ChEMBL: CHEMBL5319] [GtoPdb: 1843] [UniProtKB: Q08345]
There should be some charts here, you may need to enable JavaScript!
  • eukaryotic translation initiation factor 2 alpha kinase 1/Eukaryotic translation initiation factor 2-alpha kinase 1 in Human [ChEMBL: CHEMBL6029] [GtoPdb: 2015] [UniProtKB: Q9BQI3]
There should be some charts here, you may need to enable JavaScript!
  • Eukaryotic translation initiation factor 5B in Human [ChEMBL: CHEMBL4105852] [UniProtKB: O60841]
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
  • fibroblast growth factor receptor 1/Fibroblast growth factor receptor 1 in Human [ChEMBL: CHEMBL3650] [GtoPdb: 1808] [UniProtKB: P11362]
There should be some charts here, you may need to enable JavaScript!
  • protein tyrosine kinase 2/Focal adhesion kinase 1 in Human [ChEMBL: CHEMBL2695] [GtoPdb: 2180] [UniProtKB: Q05397]
There should be some charts here, you may need to enable JavaScript!
  • General transcription and DNA repair factor IIH helicase subunit XPD in Human [ChEMBL: CHEMBL4105743] [UniProtKB: P18074]
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
  • Glycogen phosphorylase, brain form in Human [ChEMBL: CHEMBL3856] [UniProtKB: P11216]
There should be some charts here, you may need to enable JavaScript!
  • Glycogen phosphorylase, liver form in Human [ChEMBL: CHEMBL2568] [UniProtKB: P06737]
There should be some charts here, you may need to enable JavaScript!
  • glycogen synthase kinase 3 alpha/Glycogen synthase kinase-3 alpha in Human [ChEMBL: CHEMBL2850] [GtoPdb: 2029] [UniProtKB: P49840]
There should be some charts here, you may need to enable JavaScript!
  • glycogen synthase kinase 3 beta/Glycogen synthase kinase-3 beta in Human [ChEMBL: CHEMBL262] [GtoPdb: 2030] [UniProtKB: P49841]
There should be some charts here, you may need to enable JavaScript!
  • G protein-coupled receptor kinase 6 in Human [ChEMBL: CHEMBL6144] [GtoPdb: 1470] [UniProtKB: P43250]
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
  • Guanine nucleotide-binding protein G(i) subunit alpha-2 in Human [ChEMBL: CHEMBL4105887] [UniProtKB: P04899]
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
  • Haem oxygenase 2/Heme oxygenase 2 in Human [ChEMBL: CHEMBL2546] [GtoPdb: 1442] [UniProtKB: P30519]
There should be some charts here, you may need to enable JavaScript!
  • MET proto-oncogene, receptor tyrosine kinase/Hepatocyte growth factor receptor in Human [ChEMBL: CHEMBL3717] [GtoPdb: 1815] [UniProtKB: P08581]
There should be some charts here, you may need to enable JavaScript!
  • neurotrophic receptor tyrosine kinase 1/High affinity nerve growth factor receptor in Human [ChEMBL: CHEMBL2815] [GtoPdb: 1817] [UniProtKB: P04629]
There should be some charts here, you may need to enable JavaScript!
  • inhibitor of nuclear factor kappa B kinase subunit epsilon/Inhibitor of nuclear factor kappa-B kinase subunit epsilon in Human [ChEMBL: CHEMBL3529] [GtoPdb: 2040] [UniProtKB: Q14164]
There should be some charts here, you may need to enable JavaScript!
  • inosine monophosphate dehydrogenase 2/Inosine-5`-monophosphate dehydrogenase 2 in Human [ChEMBL: CHEMBL2002] [GtoPdb: 2625] [UniProtKB: P12268]
There should be some charts here, you may need to enable JavaScript!
  • Insulin-like growth factor I receptor/Insulin-like growth factor 1 receptor in Human [ChEMBL: CHEMBL1957] [GtoPdb: 1801] [UniProtKB: P08069]
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
  • integrin linked kinase/Integrin-linked protein kinase in Human [ChEMBL: CHEMBL5247] [GtoPdb: 2041] [UniProtKB: Q13418]
There should be some charts here, you may need to enable JavaScript!
  • interleukin 1 receptor associated kinase 1/Interleukin-1 receptor-associated kinase 1 in Human [ChEMBL: CHEMBL3357] [GtoPdb: 2042] [UniProtKB: P51617]
There should be some charts here, you may need to enable JavaScript!
  • interleukin 1 receptor associated kinase 3/Interleukin-1 receptor-associated kinase 3 in Human [ChEMBL: CHEMBL5081] [GtoPdb: 2044] [UniProtKB: Q9Y616]
There should be some charts here, you may need to enable JavaScript!
  • interleukin 1 receptor associated kinase 4/Interleukin-1 receptor-associated kinase 4 in Human [ChEMBL: CHEMBL3778] [GtoPdb: 2045] [UniProtKB: Q9NWZ3]
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
  • macrophage stimulating 1 receptor/Macrophage-stimulating protein receptor in Human [ChEMBL: CHEMBL2689] [GtoPdb: 1816] [UniProtKB: Q04912]
There should be some charts here, you may need to enable JavaScript!
  • MAPK activated protein kinase 2/MAP kinase-activated protein kinase 2 in Human [ChEMBL: CHEMBL2208] [GtoPdb: 2094] [UniProtKB: P49137]
There should be some charts here, you may need to enable JavaScript!
  • MAPK activated protein kinase 5/MAP kinase-activated protein kinase 5 in Human [ChEMBL: CHEMBL3094] [GtoPdb: 2096] [UniProtKB: Q8IW41]
There should be some charts here, you may need to enable JavaScript!
  • microtubule affinity regulating kinase 3/MAP/microtubule affinity-regulating kinase 3 in Human [ChEMBL: CHEMBL5600] [GtoPdb: 2099] [UniProtKB: P27448]
There should be some charts here, you may need to enable JavaScript!
  • microtubule affinity regulating kinase 4/MAP/microtubule affinity-regulating kinase 4 in Human [ChEMBL: CHEMBL5754] [GtoPdb: 2100] [UniProtKB: Q96L34]
There should be some charts here, you may need to enable JavaScript!
  • maternal embryonic leucine zipper kinase/Maternal embryonic leucine zipper kinase in Human [ChEMBL: CHEMBL4578] [GtoPdb: 2102] [UniProtKB: Q14680]
There should be some charts here, you may need to enable JavaScript!
  • Membrane-associated progesterone receptor component 1 in Human [ChEMBL: CHEMBL4105706] [UniProtKB: O00264]
There should be some charts here, you may need to enable JavaScript!
  • protein kinase, membrane associated tyrosine/threonine 1/Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase in Human [ChEMBL: CHEMBL3984] [GtoPdb: 2167] [UniProtKB: Q99640]
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
  • misshapen like kinase 1/Misshapen-like kinase 1 in Human [ChEMBL: CHEMBL5518] [GtoPdb: 2103] [UniProtKB: Q8N4C8]
There should be some charts here, you may need to enable JavaScript!
  • mitogen-activated protein kinase 1/Mitogen-activated protein kinase 1 in Human [ChEMBL: CHEMBL4040] [GtoPdb: 1495] [UniProtKB: P28482]
There should be some charts here, you may need to enable JavaScript!
  • mitogen-activated protein kinase 10/Mitogen-activated protein kinase 10 in Human [ChEMBL: CHEMBL2637] [GtoPdb: 1498] [UniProtKB: P53779]
There should be some charts here, you may need to enable JavaScript!
  • mitogen-activated protein kinase 11/Mitogen-activated protein kinase 11 in Human [ChEMBL: CHEMBL3961] [GtoPdb: 1500] [UniProtKB: Q15759]
There should be some charts here, you may need to enable JavaScript!
  • mitogen-activated protein kinase 14/Mitogen-activated protein kinase 14 in Human [ChEMBL: CHEMBL260] [GtoPdb: 1499] [UniProtKB: Q16539]
There should be some charts here, you may need to enable JavaScript!
  • mitogen-activated protein kinase 15/Mitogen-activated protein kinase 15 in Human [ChEMBL: CHEMBL5198] [GtoPdb: 2090] [UniProtKB: Q8TD08]
There should be some charts here, you may need to enable JavaScript!
  • mitogen-activated protein kinase 3/Mitogen-activated protein kinase 3 in Human [ChEMBL: CHEMBL3385] [GtoPdb: 1494] [UniProtKB: P27361]
There should be some charts here, you may need to enable JavaScript!
  • mitogen-activated protein kinase 7/Mitogen-activated protein kinase 7 in Human [ChEMBL: CHEMBL5332] [GtoPdb: 2093] [UniProtKB: Q13164]
There should be some charts here, you may need to enable JavaScript!
  • mitogen-activated protein kinase 8/Mitogen-activated protein kinase 8 in Human [ChEMBL: CHEMBL2276] [GtoPdb: 1496] [UniProtKB: P45983]
There should be some charts here, you may need to enable JavaScript!
  • mitogen-activated protein kinase 9/Mitogen-activated protein kinase 9 in Human [ChEMBL: CHEMBL4179] [GtoPdb: 1497] [UniProtKB: P45984]
There should be some charts here, you may need to enable JavaScript!
  • mitogen-activated protein kinase kinase kinase 1/Mitogen-activated protein kinase kinase kinase 1 in Human [ChEMBL: CHEMBL3956] [GtoPdb: 2069] [UniProtKB: Q13233]
There should be some charts here, you may need to enable JavaScript!
  • mitogen-activated protein kinase kinase kinase 11/Mitogen-activated protein kinase kinase kinase 11 in Human [ChEMBL: CHEMBL2708] [GtoPdb: 2071] [UniProtKB: Q16584]
There should be some charts here, you may need to enable JavaScript!
  • mitogen-activated protein kinase kinase kinase 2/Mitogen-activated protein kinase kinase kinase 2 in Human [ChEMBL: CHEMBL5914] [GtoPdb: 2077] [UniProtKB: Q9Y2U5]
There should be some charts here, you may need to enable JavaScript!
  • ZAK sterile alpha motif and leucine zipper containing kinase AZK/Mitogen-activated protein kinase kinase kinase 20 in Human [ChEMBL: CHEMBL3886] [GtoPdb: 2289] [UniProtKB: Q9NYL2]
There should be some charts here, you may need to enable JavaScript!
  • mitogen-activated protein kinase kinase kinase 3/Mitogen-activated protein kinase kinase kinase 3 in Human [ChEMBL: CHEMBL5970] [GtoPdb: 2078] [UniProtKB: Q99759]
There should be some charts here, you may need to enable JavaScript!
  • mitogen-activated protein kinase kinase kinase 4/Mitogen-activated protein kinase kinase kinase 4 in Human [ChEMBL: CHEMBL4853] [GtoPdb: 2079] [UniProtKB: Q9Y6R4]
There should be some charts here, you may need to enable JavaScript!
  • mitogen-activated protein kinase kinase kinase 5/Mitogen-activated protein kinase kinase kinase 5 in Human [ChEMBL: CHEMBL5285] [GtoPdb: 2080] [UniProtKB: Q99683]
There should be some charts here, you may need to enable JavaScript!
  • mitogen-activated protein kinase kinase kinase 6/Mitogen-activated protein kinase kinase kinase 6 in Human [ChEMBL: CHEMBL1163123] [GtoPdb: 2081] [UniProtKB: O95382]
There should be some charts here, you may need to enable JavaScript!
  • mitogen-activated protein kinase kinase kinase kinase 1/Mitogen-activated protein kinase kinase kinase kinase 1 in Human [ChEMBL: CHEMBL5749] [GtoPdb: 2085] [UniProtKB: Q92918]
There should be some charts here, you may need to enable JavaScript!
  • mitogen-activated protein kinase kinase kinase kinase 2/Mitogen-activated protein kinase kinase kinase kinase 2 in Human [ChEMBL: CHEMBL5330] [GtoPdb: 2086] [UniProtKB: Q12851]
There should be some charts here, you may need to enable JavaScript!
  • mitogen-activated protein kinase kinase kinase kinase 3/Mitogen-activated protein kinase kinase kinase kinase 3 in Human [ChEMBL: CHEMBL5432] [GtoPdb: 2087] [UniProtKB: Q8IVH8]
There should be some charts here, you may need to enable JavaScript!
  • mitogen-activated protein kinase kinase kinase kinase 4/Mitogen-activated protein kinase kinase kinase kinase 4 in Human [ChEMBL: CHEMBL6166] [GtoPdb: 2088] [UniProtKB: O95819]
There should be some charts here, you may need to enable JavaScript!
  • mitogen-activated protein kinase kinase kinase kinase 5/Mitogen-activated protein kinase kinase kinase kinase 5 in Human [ChEMBL: CHEMBL4852] [GtoPdb: 2089] [UniProtKB: Q9Y4K4]
There should be some charts here, you may need to enable JavaScript!
  • BUB1 mitotic checkpoint serine/threonine kinase/Mitotic checkpoint serine/threonine-protein kinase BUB1 in Human [ChEMBL: CHEMBL1772932] [GtoPdb: 1949] [UniProtKB: O43683]
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
  • myosin light chain kinase 3/Myosin light chain kinase in Human [ChEMBL: CHEMBL4627] [GtoPdb: 2110] [UniProtKB: Q32MK0]
There should be some charts here, you may need to enable JavaScript!
  • myosin light chain kinase/Myosin light chain kinase, smooth muscle in Human [ChEMBL: CHEMBL2428] [GtoPdb: 1552] [UniProtKB: Q15746]
There should be some charts here, you may need to enable JavaScript!
  • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 in Human [ChEMBL: CHEMBL4105781] [UniProtKB: Q9P0J0]
There should be some charts here, you may need to enable JavaScript!
  • tyrosine kinase non receptor 1/Non-receptor tyrosine-protein kinase TNK1 in Human [ChEMBL: CHEMBL5334] [GtoPdb: 2245] [UniProtKB: Q13470]
There should be some charts here, you may need to enable JavaScript!
  • tyrosine kinase 2/Non-receptor tyrosine-protein kinase TYK2 in Human [ChEMBL: CHEMBL3553] [GtoPdb: 2269] [UniProtKB: P29597]
There should be some charts here, you may need to enable JavaScript!
  • NUAK family, SNF1-like kinase, 2/NUAK family SNF1-like kinase 2 in Human [ChEMBL: CHEMBL5698] [GtoPdb: 2130] [UniProtKB: Q9H093]
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
  • PAS domain containing serine/threonine kinase/PAS domain-containing serine/threonine-protein kinase in Human [ChEMBL: CHEMBL6054] [GtoPdb: 2139] [UniProtKB: Q96RG2]
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
  • Phosphatidylethanolamine-binding protein 1 in Human [ChEMBL: CHEMBL4105856] [UniProtKB: P30086]
There should be some charts here, you may need to enable JavaScript!
  • phosphatidylinositol-5-phosphate 4-kinase type 2 alpha/Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha in Human [ChEMBL: CHEMBL1795194] [GtoPdb: 2858] [UniProtKB: P48426]
There should be some charts here, you may need to enable JavaScript!
  • phosphatidylinositol-5-phosphate 4-kinase type 2 gamma/Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma in Human [ChEMBL: CHEMBL1770034] [GtoPdb: 2163] [UniProtKB: Q8TBX8]
There should be some charts here, you may need to enable JavaScript!
  • phosphorylase kinase catalytic subunit gamma 2/Phosphorylase b kinase gamma catalytic chain, liver/testis isoform in Human [ChEMBL: CHEMBL2349] [GtoPdb: 2147] [UniProtKB: P15735]
There should be some charts here, you may need to enable JavaScript!
  • platelet derived growth factor receptor beta/Platelet-derived growth factor receptor beta in Human [ChEMBL: CHEMBL1913] [GtoPdb: 1804] [UniProtKB: P09619]
There should be some charts here, you may need to enable JavaScript!
  • Probable ATP-dependent RNA helicase DDX6 in Human [ChEMBL: CHEMBL4105783] [UniProtKB: P26196]
There should be some charts here, you may need to enable JavaScript!
  • protein kinase C alpha/Protein kinase C alpha type in Human [ChEMBL: CHEMBL299] [GtoPdb: 1482] [UniProtKB: P17252]
There should be some charts here, you may need to enable JavaScript!
  • protein kinase C beta/Protein kinase C beta type in Human [ChEMBL: CHEMBL3045] [GtoPdb: 1483] [UniProtKB: P05771]
There should be some charts here, you may need to enable JavaScript!
  • protein kinase C delta/Protein kinase C delta type in Human [ChEMBL: CHEMBL2996] [GtoPdb: 1485] [UniProtKB: Q05655]
There should be some charts here, you may need to enable JavaScript!
  • protein kinase C iota/Protein kinase C iota type in Human [ChEMBL: CHEMBL2598] [GtoPdb: 1490] [UniProtKB: P41743]
There should be some charts here, you may need to enable JavaScript!
  • protein kinase C theta/Protein kinase C theta type in Human [ChEMBL: CHEMBL3920] [GtoPdb: 1488] [UniProtKB: Q04759]
There should be some charts here, you may need to enable JavaScript!
  • protein kinase C zeta/Protein kinase C zeta type in Human [ChEMBL: CHEMBL3438] [GtoPdb: 1491] [UniProtKB: Q05513]
There should be some charts here, you may need to enable JavaScript!
  • protein tyrosine kinase 2 beta/Protein-tyrosine kinase 2-beta in Human [ChEMBL: CHEMBL5469] [GtoPdb: 2181] [UniProtKB: Q14289]
There should be some charts here, you may need to enable JavaScript!
  • protein tyrosine kinase 6/Protein-tyrosine kinase 6 in Human [ChEMBL: CHEMBL4601] [GtoPdb: 2182] [UniProtKB: Q13882]
There should be some charts here, you may need to enable JavaScript!
  • ret proto-oncogene/Proto-oncogene tyrosine-protein kinase receptor Ret in Human [ChEMBL: CHEMBL2041] [GtoPdb: 2185] [UniProtKB: P07949]
There should be some charts here, you may need to enable JavaScript!
  • SRC proto-oncogene, non-receptor tyrosine kinase/Proto-oncogene tyrosine-protein kinase Src in Human [ChEMBL: CHEMBL267] [GtoPdb: 2206] [UniProtKB: P12931]
There should be some charts here, you may need to enable JavaScript!
  • Putative heat shock protein HSP 90-beta 2 in Human [ChEMBL: CHEMBL4105858] [UniProtKB: Q58FF8]
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
  • AKT serine/threonine kinase 1/RAC-alpha serine/threonine-protein kinase in Human [ChEMBL: CHEMBL4282] [GtoPdb: 1479] [UniProtKB: P31749]
There should be some charts here, you may need to enable JavaScript!
  • AKT serine/threonine kinase 2/RAC-beta serine/threonine-protein kinase in Human [ChEMBL: CHEMBL2431] [GtoPdb: 1480] [UniProtKB: P31751]
There should be some charts here, you may need to enable JavaScript!
  • AKT serine/threonine kinase 3/RAC-gamma serine/threonine-protein kinase in Human [ChEMBL: CHEMBL4816] [GtoPdb: 2286] [UniProtKB: Q9Y243]
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
  • RAB27A, member RAS oncogene family/Ras-related protein Rab-27A in Human [ChEMBL: CHEMBL4105702] [GtoPdb: 2916] [UniProtKB: P51159]
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
  • receptor interacting serine/threonine kinase 2/Receptor-interacting serine/threonine-protein kinase 2 in Human [ChEMBL: CHEMBL5014] [GtoPdb: 2190] [UniProtKB: O43353]
There should be some charts here, you may need to enable JavaScript!
  • receptor interacting serine/threonine kinase 3/Receptor-interacting serine/threonine-protein kinase 3 in Human [ChEMBL: CHEMBL1795199] [GtoPdb: 2191] [UniProtKB: Q9Y572]
There should be some charts here, you may need to enable JavaScript!
  • fms related receptor tyrosine kinase 3/Receptor-type tyrosine-protein kinase FLT3 in Human [ChEMBL: CHEMBL1974] [GtoPdb: 1807] [UniProtKB: P36888]
There should be some charts here, you may need to enable JavaScript!
  • Rho associated coiled-coil containing protein kinase 1/Rho-associated protein kinase 1 in Human [ChEMBL: CHEMBL3231] [GtoPdb: 1503] [UniProtKB: Q13464]
There should be some charts here, you may need to enable JavaScript!
  • Rho associated coiled-coil containing protein kinase 2/Rho-associated protein kinase 2 in Human [ChEMBL: CHEMBL2973] [GtoPdb: 1504] [UniProtKB: O75116]
There should be some charts here, you may need to enable JavaScript!
  • ribosomal protein S6 kinase A1/Ribosomal protein S6 kinase alpha-1 in Human [ChEMBL: CHEMBL2553] [GtoPdb: 1527] [UniProtKB: Q15418]
There should be some charts here, you may need to enable JavaScript!
  • ribosomal protein S6 kinase A3/Ribosomal protein S6 kinase alpha-3 in Human [ChEMBL: CHEMBL2345] [GtoPdb: 1528] [UniProtKB: P51812]
There should be some charts here, you may need to enable JavaScript!
  • ribosomal protein S6 kinase A4/Ribosomal protein S6 kinase alpha-4 in Human [ChEMBL: CHEMBL3125] [GtoPdb: 1524] [UniProtKB: O75676]
There should be some charts here, you may need to enable JavaScript!
  • ribosomal protein S6 kinase A5/Ribosomal protein S6 kinase alpha-5 in Human [ChEMBL: CHEMBL4237] [GtoPdb: 1523] [UniProtKB: O75582]
There should be some charts here, you may need to enable JavaScript!
  • ribosomal protein S6 kinase A6/Ribosomal protein S6 kinase alpha-6 in Human [ChEMBL: CHEMBL4924] [GtoPdb: 1530] [UniProtKB: Q9UK32]
There should be some charts here, you may need to enable JavaScript!
  • ribosomal protein S6 kinase B1/Ribosomal protein S6 kinase beta-1 in Human [ChEMBL: CHEMBL4501] [GtoPdb: 1525] [UniProtKB: P23443]
There should be some charts here, you may need to enable JavaScript!
  • Ribosyldihydronicotinamide dehydrogenase [quinone] in Human [ChEMBL: CHEMBL3959] [UniProtKB: P16083]
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
  • methionine adenosyltransferase 2A/S-adenosylmethionine synthase isoform type-2 in Human [ChEMBL: CHEMBL3313835] [GtoPdb: 3341] [UniProtKB: P31153]
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
  • serine/threonine kinase 10/Serine/threonine-protein kinase 10 in Human [ChEMBL: CHEMBL3981] [GtoPdb: 2211] [UniProtKB: O94804]
There should be some charts here, you may need to enable JavaScript!
  • serine/threonine kinase 16/Serine/threonine-protein kinase 16 in Human [ChEMBL: CHEMBL3938] [GtoPdb: 2213] [UniProtKB: O75716]
There should be some charts here, you may need to enable JavaScript!
  • serine/threonine kinase 24/Serine/threonine-protein kinase 24 in Human [ChEMBL: CHEMBL5082] [GtoPdb: 2217] [UniProtKB: Q9Y6E0]
There should be some charts here, you may need to enable JavaScript!
  • serine/threonine-protein kinase MST4/Serine/threonine-protein kinase 26 in Human [ChEMBL: CHEMBL5941] [GtoPdb: 2287] [UniProtKB: Q9P289]
There should be some charts here, you may need to enable JavaScript!
  • serine/threonine kinase 3/Serine/threonine-protein kinase 3 in Human [ChEMBL: CHEMBL4708] [GtoPdb: 2219] [UniProtKB: Q13188]
There should be some charts here, you may need to enable JavaScript!
  • Serine/threonine kinase 38 like/Serine/threonine-protein kinase 38-like in Human [ChEMBL: CHEMBL4851] [GtoPdb: 1518] [UniProtKB: Q9Y2H1]
There should be some charts here, you may need to enable JavaScript!
  • serine/threonine kinase 4/Serine/threonine-protein kinase 4 in Human [ChEMBL: CHEMBL4598] [GtoPdb: 2225] [UniProtKB: Q13043]
There should be some charts here, you may need to enable JavaScript!
  • A-Raf proto-oncogene, serine/threonine kinase/Serine/threonine-protein kinase A-Raf in Human [ChEMBL: CHEMBL1169596] [GtoPdb: 1933] [UniProtKB: P10398]
There should be some charts here, you may need to enable JavaScript!
  • ATR checkpoint kinase/Serine/threonine-protein kinase ATR in Human [ChEMBL: CHEMBL5024] [GtoPdb: 1935] [UniProtKB: Q13535]
There should be some charts here, you may need to enable JavaScript!
  • B-Raf proto-oncogene, serine/threonine kinase/Serine/threonine-protein kinase B-raf in Human [ChEMBL: CHEMBL5145] [GtoPdb: 1943] [UniProtKB: P15056]
There should be some charts here, you may need to enable JavaScript!
  • checkpoint kinase 1/Serine/threonine-protein kinase Chk1 in Human [ChEMBL: CHEMBL4630] [GtoPdb: 1987] [UniProtKB: O14757]
There should be some charts here, you may need to enable JavaScript!
  • protein kinase D2/Serine/threonine-protein kinase D2 in Human [ChEMBL: CHEMBL4900] [GtoPdb: 2173] [UniProtKB: Q9BZL6]
There should be some charts here, you may need to enable JavaScript!
  • protein kinase D3/Serine/threonine-protein kinase D3 in Human [ChEMBL: CHEMBL2595] [GtoPdb: 2174] [UniProtKB: O94806]
There should be some charts here, you may need to enable JavaScript!
  • endoplasmic reticulum to nucleus signaling 1/Serine/threonine-protein kinase/endoribonuclease IRE1 in Human [ChEMBL: CHEMBL1163101] [GtoPdb: 2020] [UniProtKB: O75460]
There should be some charts here, you may need to enable JavaScript!
  • endoplasmic reticulum to nucleus signaling 2/Serine/threonine-protein kinase/endoribonuclease IRE2 in Human [ChEMBL: CHEMBL4105932] [GtoPdb: 2021] [UniProtKB: Q76MJ5]
There should be some charts here, you may need to enable JavaScript!
  • ciliogenesis associated kinase 1/Serine/threonine-protein kinase ICK in Human [ChEMBL: CHEMBL1163126] [GtoPdb: 2038] [UniProtKB: Q9UPZ9]
There should be some charts here, you may need to enable JavaScript!
  • large tumor suppressor kinase 1/Serine/threonine-protein kinase LATS1 in Human [ChEMBL: CHEMBL6167] [GtoPdb: 1515] [UniProtKB: O95835]
There should be some charts here, you may need to enable JavaScript!
  • microtubule affinity regulating kinase 2/Serine/threonine-protein kinase MARK2 in Human [ChEMBL: CHEMBL3831] [GtoPdb: 2098] [UniProtKB: Q7KZI7]
There should be some charts here, you may need to enable JavaScript!
  • CDC42 binding protein kinase alpha/Serine/threonine-protein kinase MRCK alpha in Human [ChEMBL: CHEMBL4516] [GtoPdb: 1507] [UniProtKB: Q5VT25]
There should be some charts here, you may need to enable JavaScript!
  • CDC42 binding protein kinase beta/Serine/threonine-protein kinase MRCK beta in Human [ChEMBL: CHEMBL5052] [GtoPdb: 1508] [UniProtKB: Q9Y5S2]
There should be some charts here, you may need to enable JavaScript!
  • CDC42 binding protein kinase gamma/Serine/threonine-protein kinase MRCK gamma in Human [ChEMBL: CHEMBL5615] [GtoPdb: 1506] [UniProtKB: Q6DT37]
There should be some charts here, you may need to enable JavaScript!
  • protein kinase N1/Serine/threonine-protein kinase N1 in Human [ChEMBL: CHEMBL3384] [GtoPdb: 1520] [UniProtKB: Q16512]
There should be some charts here, you may need to enable JavaScript!
  • protein kinase N2/Serine/threonine-protein kinase N2 in Human [ChEMBL: CHEMBL3032] [GtoPdb: 1521] [UniProtKB: Q16513]
There should be some charts here, you may need to enable JavaScript!
  • protein kinase N3/Serine/threonine-protein kinase N3 in Human [ChEMBL: CHEMBL3627581] [GtoPdb: 1522] [UniProtKB: Q6P5Z2]
There should be some charts here, you may need to enable JavaScript!
  • NIMA related kinase 1/Serine/threonine-protein kinase Nek1 in Human [ChEMBL: CHEMBL5855] [GtoPdb: 2114] [UniProtKB: Q96PY6]
There should be some charts here, you may need to enable JavaScript!
  • NIMA related kinase 2/Serine/threonine-protein kinase Nek2 in Human [ChEMBL: CHEMBL3835] [GtoPdb: 2117] [UniProtKB: P51955]
There should be some charts here, you may need to enable JavaScript!
  • NIMA related kinase 3/Serine/threonine-protein kinase Nek3 in Human [ChEMBL: CHEMBL5679] [GtoPdb: 2118] [UniProtKB: P51956]
There should be some charts here, you may need to enable JavaScript!
  • NIMA related kinase 7/Serine/threonine-protein kinase Nek7 in Human [ChEMBL: CHEMBL4849] [GtoPdb: 2122] [UniProtKB: Q8TDX7]
There should be some charts here, you may need to enable JavaScript!
  • NIMA related kinase 9/Serine/threonine-protein kinase Nek9 in Human [ChEMBL: CHEMBL5257] [GtoPdb: 2124] [UniProtKB: Q8TD19]
There should be some charts here, you may need to enable JavaScript!
  • nemo like kinase/Serine/threonine-protein kinase NLK in Human [ChEMBL: CHEMBL5364] [GtoPdb: 2125] [UniProtKB: Q9UBE8]
There should be some charts here, you may need to enable JavaScript!
  • p21 (RAC1) activated kinase 2/Serine/threonine-protein kinase PAK 2 in Human [ChEMBL: CHEMBL4487] [GtoPdb: 2134] [UniProtKB: Q13177]
There should be some charts here, you may need to enable JavaScript!
  • p21 (RAC1) activated kinase 4/Serine/threonine-protein kinase PAK 4 in Human [ChEMBL: CHEMBL4482] [GtoPdb: 2136] [UniProtKB: O96013]
There should be some charts here, you may need to enable JavaScript!
  • p21 (RAC1) activated kinase 6/Serine/threonine-protein kinase PAK 6 in Human [ChEMBL: CHEMBL4311] [GtoPdb: 2137] [UniProtKB: Q9NQU5]
There should be some charts here, you may need to enable JavaScript!
  • Pim-1 proto-oncogene, serine/threonine kinase/Serine/threonine-protein kinase pim-1 in Human [ChEMBL: CHEMBL2147] [GtoPdb: 2158] [UniProtKB: P11309]
There should be some charts here, you may need to enable JavaScript!
  • Pim-2 proto-oncogene, serine/threonine kinase/Serine/threonine-protein kinase pim-2 in Human [ChEMBL: CHEMBL4523] [GtoPdb: 2159] [UniProtKB: Q9P1W9]
There should be some charts here, you may need to enable JavaScript!
  • polo like kinase 4/Serine/threonine-protein kinase PLK4 in Human [ChEMBL: CHEMBL3788] [GtoPdb: 2171] [UniProtKB: O00444]
There should be some charts here, you may need to enable JavaScript!
  • salt inducible kinase 2/Serine/threonine-protein kinase SIK2 in Human [ChEMBL: CHEMBL5699] [GtoPdb: 2198] [UniProtKB: Q9H0K1]
There should be some charts here, you may need to enable JavaScript!
  • SIK family kinase 3/Serine/threonine-protein kinase SIK3 in Human [ChEMBL: CHEMBL6149] [GtoPdb: 2199] [UniProtKB: Q9Y2K2]
There should be some charts here, you may need to enable JavaScript!
  • serine/threonine kinase 11/Serine/threonine-protein kinase STK11 in Human [ChEMBL: CHEMBL5606] [GtoPdb: 2212] [UniProtKB: Q15831]
There should be some charts here, you may need to enable JavaScript!
  • TAO kinase 1/Serine/threonine-protein kinase TAO1 in Human [ChEMBL: CHEMBL5261] [GtoPdb: 2233] [UniProtKB: Q7L7X3]
There should be some charts here, you may need to enable JavaScript!
  • TAO kinase 2/Serine/threonine-protein kinase TAO2 in Human [ChEMBL: CHEMBL1075195] [GtoPdb: 2234] [UniProtKB: Q9UL54]
There should be some charts here, you may need to enable JavaScript!
  • TAO kinase 3/Serine/threonine-protein kinase TAO3 in Human [ChEMBL: CHEMBL5701] [GtoPdb: 2235] [UniProtKB: Q9H2K8]
There should be some charts here, you may need to enable JavaScript!
  • TANK binding kinase 1/Serine/threonine-protein kinase TBK1 in Human [ChEMBL: CHEMBL5408] [GtoPdb: 2237] [UniProtKB: Q9UHD2]
There should be some charts here, you may need to enable JavaScript!
  • unc-51 like autophagy activating kinase 1/Serine/threonine-protein kinase ULK1 in Human [ChEMBL: CHEMBL6006] [GtoPdb: 2271] [UniProtKB: O75385]
There should be some charts here, you may need to enable JavaScript!
  • unc-51 like kinase 3/Serine/threonine-protein kinase ULK3 in Human [ChEMBL: CHEMBL5047] [GtoPdb: 2273] [UniProtKB: Q6PHR2]
There should be some charts here, you may need to enable JavaScript!
  • Signal recognition particle receptor subunit alpha in Human [ChEMBL: CHEMBL4105934] [UniProtKB: P08240]
There should be some charts here, you may need to enable JavaScript!
  • STE20 like kinase/STE20-like serine/threonine-protein kinase in Human [ChEMBL: CHEMBL4202] [GtoPdb: 2200] [UniProtKB: Q9H2G2]
There should be some charts here, you may need to enable JavaScript!
  • STE20 related adaptor alpha/STE20-related kinase adapter protein alpha in Human [ChEMBL: CHEMBL1795198] [GtoPdb: 2227] [UniProtKB: Q7RTN6]
There should be some charts here, you may need to enable JavaScript!
  • Structural maintenance of chromosomes protein 1A in Human [ChEMBL: CHEMBL4105747] [UniProtKB: Q14683]
There should be some charts here, you may need to enable JavaScript!
  • Structural maintenance of chromosomes protein 2 in Human [ChEMBL: CHEMBL4105890] [UniProtKB: O95347]
There should be some charts here, you may need to enable JavaScript!
  • Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial in Human [ChEMBL: CHEMBL4105973] [UniProtKB: Q9P2R7]
There should be some charts here, you may need to enable JavaScript!
  • transforming growth factor beta receptor 1/TGF-beta receptor type-1 in Human [ChEMBL: CHEMBL4439] [GtoPdb: 1788] [UniProtKB: P36897]
There should be some charts here, you may need to enable JavaScript!
  • transforming growth factor beta receptor 2/TGF-beta receptor type-2 in Human [ChEMBL: CHEMBL4267] [GtoPdb: 1795] [UniProtKB: P37173]
There should be some charts here, you may need to enable JavaScript!
  • Thyroid hormone receptor-associated protein 3 in Human [ChEMBL: CHEMBL4105820] [UniProtKB: Q9Y2W1]
There should be some charts here, you may need to enable JavaScript!
  • TRAF2 and NCK interacting kinase/TRAF2 and NCK-interacting protein kinase in Human [ChEMBL: CHEMBL4527] [GtoPdb: 2244] [UniProtKB: Q9UKE5]
There should be some charts here, you may need to enable JavaScript!
  • ABL proto-oncogene 1, non-receptor tyrosine kinase/Tyrosine-protein kinase ABL1 in Human [ChEMBL: CHEMBL1862] [GtoPdb: 1923] [UniProtKB: P00519]
There should be some charts here, you may need to enable JavaScript!
  • ABL proto-oncogene 2, non-receptor tyrosine kinase/Tyrosine-protein kinase ABL2 in Human [ChEMBL: CHEMBL4014] [GtoPdb: 1924] [UniProtKB: P42684]
There should be some charts here, you may need to enable JavaScript!
  • Bruton tyrosine kinase/Tyrosine-protein kinase BTK in Human [ChEMBL: CHEMBL5251] [GtoPdb: 1948] [UniProtKB: Q06187]
There should be some charts here, you may need to enable JavaScript!
  • C-terminal Src kinase/Tyrosine-protein kinase CSK in Human [ChEMBL: CHEMBL2634] [GtoPdb: 1994] [UniProtKB: P41240]
There should be some charts here, you may need to enable JavaScript!
  • FER tyrosine kinase/Tyrosine-protein kinase Fer in Human [ChEMBL: CHEMBL3982] [GtoPdb: 2022] [UniProtKB: P16591]
There should be some charts here, you may need to enable JavaScript!
  • FES proto-oncogene, tyrosine kinase/Tyrosine-protein kinase Fes/Fps in Human [ChEMBL: CHEMBL5455] [GtoPdb: 2023] [UniProtKB: P07332]
There should be some charts here, you may need to enable JavaScript!
  • fyn related Src family tyrosine kinase/Tyrosine-protein kinase FRK in Human [ChEMBL: CHEMBL4223] [GtoPdb: 2025] [UniProtKB: P42685]
There should be some charts here, you may need to enable JavaScript!
  • FYN proto-oncogene, Src family tyrosine kinase/Tyrosine-protein kinase Fyn in Human [ChEMBL: CHEMBL1841] [GtoPdb: 2026] [UniProtKB: P06241]
There should be some charts here, you may need to enable JavaScript!
  • HCK proto-oncogene, Src family tyrosine kinase/Tyrosine-protein kinase HCK in Human [ChEMBL: CHEMBL3234] [GtoPdb: 2032] [UniProtKB: P08631]
There should be some charts here, you may need to enable JavaScript!
  • Janus kinase 1/Tyrosine-protein kinase JAK1 in Human [ChEMBL: CHEMBL2835] [GtoPdb: 2047] [UniProtKB: P23458]
There should be some charts here, you may need to enable JavaScript!
  • LCK proto-oncogene, Src family tyrosine kinase/Tyrosine-protein kinase Lck in Human [ChEMBL: CHEMBL258] [GtoPdb: 2053] [UniProtKB: P06239]
There should be some charts here, you may need to enable JavaScript!
  • LYN proto-oncogene, Src family tyrosine kinase/Tyrosine-protein kinase Lyn in Human [ChEMBL: CHEMBL3905] [GtoPdb: 2060] [UniProtKB: P07948]
There should be some charts here, you may need to enable JavaScript!
  • MER proto-oncogene, tyrosine kinase/Tyrosine-protein kinase Mer in Human [ChEMBL: CHEMBL5331] [GtoPdb: 1837] [UniProtKB: Q12866]
There should be some charts here, you may need to enable JavaScript!
  • spleen associated tyrosine kinase/Tyrosine-protein kinase SYK in Human [ChEMBL: CHEMBL2599] [GtoPdb: 2230] [UniProtKB: P43405]
There should be some charts here, you may need to enable JavaScript!
  • tec protein tyrosine kinase/Tyrosine-protein kinase Tec in Human [ChEMBL: CHEMBL4246] [GtoPdb: 2238] [UniProtKB: P42680]
There should be some charts here, you may need to enable JavaScript!
  • YES proto-oncogene 1, Src family tyrosine kinase/Tyrosine-protein kinase Yes in Human [ChEMBL: CHEMBL2073] [GtoPdb: 2284] [UniProtKB: P07947]
There should be some charts here, you may need to enable JavaScript!
  • Tyrosine--tRNA ligase, cytoplasmic in Human [ChEMBL: CHEMBL3179] [UniProtKB: P54577]
There should be some charts here, you may need to enable JavaScript!
  • U5 small nuclear ribonucleoprotein 200 kDa helicase in Human [ChEMBL: CHEMBL4105972] [UniProtKB: O75643]
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
  • aarF domain containing kinase 5/Uncharacterized aarF domain-containing protein kinase 5 in Human [ChEMBL: CHEMBL4105886] [GtoPdb: 1929] [UniProtKB: Q3MIX3]
There should be some charts here, you may need to enable JavaScript!
There should be some charts here, you may need to enable JavaScript!
  • Very long-chain specific acyl-CoA dehydrogenase, mitochondrial in Human [ChEMBL: CHEMBL4105892] [UniProtKB: P49748]
There should be some charts here, you may need to enable JavaScript!
  • WEE1 G2 checkpoint kinase/Wee1-like protein kinase in Human [ChEMBL: CHEMBL5491] [GtoPdb: 2278] [UniProtKB: P30291]
There should be some charts here, you may need to enable JavaScript!
DB Assay description Assay Type Standard value Standard parameter Original value Original units Original parameter Reference
26S proteasome regulatory subunit 6B in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3831205] [UniProtKB: P43686]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein kinase AMP-activated catalytic subunit alpha 1/5`-AMP-activated protein kinase catalytic subunit alpha-1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4045] [GtoPdb: 1541] [UniProtKB: Q13131]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein kinase AMP-activated non-catalytic subunit gamma 1/5`-AMP-activated protein kinase subunit gamma-1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2393] [GtoPdb: 1545] [UniProtKB: P54619]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein kinase AMP-activated non-catalytic subunit gamma 2/5`-AMP-activated protein kinase subunit gamma-2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2453] [GtoPdb: 1546] [UniProtKB: Q9UGJ0]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
aarF domain containing kinase 1/AarF domain-containing protein kinase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105885] [GtoPdb: 1925] [UniProtKB: Q86TW2]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Actin-related protein 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL6090] [UniProtKB: P61160]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Actin-related protein 3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105857] [UniProtKB: P61158]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
tyrosine kinase non receptor 2/Activated CDC42 kinase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4599] [GtoPdb: 2246] [UniProtKB: Q07912]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
activin A receptor type 1/Activin receptor type-1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5903] [GtoPdb: 1785] [UniProtKB: Q04771]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
activin A receptor type 1B/Activin receptor type-1B in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5310] [GtoPdb: 1787] [UniProtKB: P36896]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
activin A receptor type 2B/Activin receptor type-2B in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5466] [GtoPdb: 1792] [UniProtKB: Q13705]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Acyl-CoA dehydrogenase family member 10 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105816] [UniProtKB: Q6JQN1]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Acyl-CoA dehydrogenase family member 11 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105707] [UniProtKB: Q709F0]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Adenine phosphoribosyltransferase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105819] [UniProtKB: P07741]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Adenosine kinase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3589] [GtoPdb: 1231] [UniProtKB: P55263]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Adenylate kinase 2, mitochondrial in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4938] [UniProtKB: P54819]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Mitochondrial adenine nucleotide translocator 2/ADP/ATP translocase 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3709670] [GtoPdb: 1063] [UniProtKB: P05141]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Mitochondrial adenine nucleotide translocator 3/ADP/ATP translocase 3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105854] [GtoPdb: 1064] [UniProtKB: P12236]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
AKR1C3/Aldo-keto reductase family 1 member C3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4681] [GtoPdb: 1382] [UniProtKB: P42330]
ChEMBL Binding affinity to human recombinant AKR1C3 extracted from Escherichia coli assessed as dissociation constant B 7.16 pKd 69 nM Kd Eur J Med Chem (2024) 275: 116540-116540 [PMID:38852338]
ChEMBL Inhibition of human AKR1C3 expressed in Escherichia coli incubated for 30 mins in presence of NADPH regeneration system by UHPLC analysis B 7.15 pKi 70 nM Ki J Med Chem (2020) 63: 11305-11329 [PMID:32463235]
ChEMBL Inhibition of AKR1C3 (unknown origin) expressed in human HCT116 cells incubated for 3 to 6 hrs by UHPLC analysis B 6.64 pIC50 230 nM IC50 J Med Chem (2020) 63: 11305-11329 [PMID:32463235]
AP2 associated kinase 1/AP2-associated protein kinase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3830] [GtoPdb: 1921] [UniProtKB: Q2M2I8]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
ATP-dependent 6-phosphofructokinase, platelet type in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2972] [UniProtKB: Q01813]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
ATP-dependent RNA helicase DDX1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2010634] [UniProtKB: Q92499]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
ATP-dependent RNA helicase DDX3X in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5553] [UniProtKB: O00571]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
ATP-dependent RNA helicase DDX42 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105782] [UniProtKB: Q86XP3]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
coenzyme Q8A/Atypical kinase COQ8A, mitochondrial in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5550] [GtoPdb: 1927] [UniProtKB: Q8NI60]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
aurora kinase A/Aurora kinase A in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4722] [GtoPdb: 1936] [UniProtKB: O14965]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
aurora kinase B/Aurora kinase B in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2185] [GtoPdb: 1937] [UniProtKB: Q96GD4]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
beta adrenergic receptor kinase 1/Beta-adrenergic receptor kinase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4079] [GtoPdb: 1466] [UniProtKB: P25098]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Bifunctional phosphoribosylaminoimidazole carboxylase/phosphoribosylaminoimidazole succinocarboxamide synthetase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5922] [UniProtKB: P22234]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
BMP2 inducible kinase/BMP-2-inducible protein kinase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4522] [GtoPdb: 1941] [UniProtKB: Q9NSY1]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
bone morphogenetic protein receptor type IA/Bone morphogenetic protein receptor type-1A in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5275] [GtoPdb: 1786] [UniProtKB: P36894]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
bone morphogenetic protein receptor type IB/Bone morphogenetic protein receptor type-1B in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5476] [GtoPdb: 1789] [UniProtKB: O00238]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
bone morphogenetic protein receptor type 2/Bone morphogenetic protein receptor type-2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5467] [GtoPdb: 1794] [UniProtKB: Q13873]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
BCR activator of RhoGEF and GTPase/Breakpoint cluster region protein in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5146] [GtoPdb: 2755] [UniProtKB: P11274]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
bromodomain containing 4/Bromodomain-containing protein 4 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1163125] [GtoPdb: 1945] [UniProtKB: O60885]
ChEMBL Inhibition of N-terminal 6His-tagged human BRD4 bromodomain 1 (44 to 168 residues) expressed in Escherichia coli BL21 (DE3) using biotinylated histone H4 peptide (1 to 21 residues) containing KAc (K5/8/12/16Ac) as substrate by Alpha screen assay B 4.72 pIC50 19000 nM IC50 Nat Rev Drug Discov (2017) 16: 424-440 [PMID:28280261]
ChEMBL Alpha Screen Assay: AlphaScreen is a bead-based, non-radioactive Amplified Luminescent Proximity Homogeneous Assay. The details are not described in this patent. B 4.76 pIC50 17220 nM IC50 US-11643396-B2. BRD4-kinase inhibitors as cancer therapeutics (2023)
bromodomain testis associated/Bromodomain testis-specific protein in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1795185] [GtoPdb: 2729] [UniProtKB: Q58F21]
ChEMBL Inhibition of N-terminal 6His-tagged human BRDT bromodomain 1 (21 to 137 residues) expressed in Escherichia coli BL21 (DE3) using biotinylated histone H4 peptide (1 to 21 residues) containing KAc (K5/8/12/16Ac) as substrate by Alpha screen assay B 4.43 pIC50 37000 nM IC50 Nat Rev Drug Discov (2017) 16: 424-440 [PMID:28280261]
ChEMBL Inhibition of human N-terminal His6-tagged BRDT (21 to 137 residues) expressed in Escherichia coli BL21 (DE3) cells incubated for 1 hr B 4.73 pIC50 18700 nM IC50 J Med Chem (2016) 59: 9305-9320 [PMID:27559828]
calcium/calmodulin dependent protein kinase kinase 2/Calcium/calmodulin-dependent protein kinase kinase 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5284] [GtoPdb: 1957] [UniProtKB: Q96RR4]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
calcium/calmodulin-dependent protein kinase II delta subunit/Calcium/calmodulin-dependent protein kinase type II subunit delta in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2801] [GtoPdb: 1558] [UniProtKB: Q13557]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
calcium/calmodulin-dependent protein kinase II gamma subunit/Calcium/calmodulin-dependent protein kinase type II subunit gamma in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3829] [GtoPdb: 1557] [UniProtKB: Q13555]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
calcium/calmodulin dependent protein kinase IV/Calcium/calmodulin-dependent protein kinase type IV in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2494] [GtoPdb: 1955] [UniProtKB: Q16566]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein kinase, cAMP-dependent, catalytic, alpha subunit/cAMP-dependent protein kinase catalytic subunit alpha in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4101] [GtoPdb: 1476] [UniProtKB: P17612]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein kinase, cAMP-dependent, catalytic, beta subunit/cAMP-dependent protein kinase catalytic subunit beta in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2918] [GtoPdb: 1477] [UniProtKB: P22694]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein kinase, cAMP-dependent, catalytic, gamma subunit/cAMP-dependent protein kinase catalytic subunit gamma in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2743] [GtoPdb: 1478] [UniProtKB: P22612]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein kinase, cAMP-dependent, regulatory, type II, alpha subunit/cAMP-dependent protein kinase type II-alpha regulatory subunit in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2221] [GtoPdb: 1474] [UniProtKB: P13861]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
casein kinase 1 alpha 1/Casein kinase I isoform alpha in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2793] [GtoPdb: 1995] [UniProtKB: P48729]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
casein kinase 1 delta/Casein kinase I isoform delta in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2828] [GtoPdb: 1997] [UniProtKB: P48730]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
casein kinase 1 epsilon/Casein kinase I isoform epsilon in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4937] [GtoPdb: 1998] [UniProtKB: P49674]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
casein kinase 1 gamma 1/Casein kinase I isoform gamma-1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2426] [GtoPdb: 1999] [UniProtKB: Q9HCP0]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
casein kinase 1 gamma 2/Casein kinase I isoform gamma-2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2543] [GtoPdb: 2000] [UniProtKB: P78368]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
casein kinase 1 gamma 3/Casein kinase I isoform gamma-3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5084] [GtoPdb: 2001] [UniProtKB: Q9Y6M4]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
casein kinase 2, alpha prime polypeptide subunit/Casein kinase II subunit alpha` in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4070] [GtoPdb: 1550] [UniProtKB: P19784]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
cyclin dependent kinase 12/CDK12/Cyclin K in Human (target type: PROTEIN COMPLEX) [ChEMBL: CHEMBL4106169] [GtoPdb: 1965] [UniProtKB: O75909Q9NYV4]
ChEMBL Inhibition of human CDK12 (696 to 1082 residues)/human cyclinK (1 to 267 residues) using pol2 CTD-peptide substrate and [gammaP]ATP by scintillation counting method B 7.4 pIC50 40 nM IC50 J Med Chem (2020) 63: 14151-14183 [PMID:33135887]
ChEMBL Inhibition of GST-tagged human CDK12/Cyclin K expressed in Sf9 cells using RBER-IRStide peptide as substrate in presence of ATP and [gamma33-P] ATP by radioisotope filter binding assay B 8.15 pIC50 7 nM IC50 J Med Chem (2022) 65: 8881-8896 [PMID:35749742]
ChEMBL Inhibition of recombinant human CDK12/Cyclin K using RNA Pol II-CTD as substrate preincubated for ~20 mins followed by 33P-ATP addition measured after 120 mins by HotSpot kinase assay B 8.52 pIC50 3 nM IC50 Eur J Med Chem (2024) 264: 116014-116014 [PMID:38061230]
cyclin dependent kinase 2/CDK2/Cyclin A1 in Human (target type: PROTEIN COMPLEX) [ChEMBL: CHEMBL3038470] [GtoPdb: 1973] [UniProtKB: P24941P78396]
ChEMBL Inhibition of CDK2/Cyclin A1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measured after 2 hrs by filter binding method B 8.52 pIC50 3 nM IC50 J Med Chem (2021) 64: 10981-10996 [PMID:34288692]
GtoPdb Inhibition of CDK2/cyclin E complex. - 8.7 pIC50 2 nM IC50 J Med Chem (2019) 62: 4606-4623 [PMID:30943029]
GtoPdb - - 9 pIC50 1 nM IC50 ACS Chem Biol (2013) 8: 2360-5 [PMID:24007471]
cyclin dependent kinase 2/CDK2/Cyclin A2 in Human (target type: PROTEIN COMPLEX) [ChEMBL: CHEMBL3038469] [GtoPdb: 1973] [UniProtKB: P20248P24941]
ChEMBL Inhibition of human full length CDK2/CyclinA2 by ADP-Glo kinase assay B 8.12 pIC50 7.51 nM IC50 Eur J Med Chem (2022) 242: 114701-114701 [PMID:36054949]
ChEMBL Inhibition of GST-tagged CDK2/Cyclin-A2 (unknown origin) expressed in Escherichia coli using histone H1 as substrate measured in presence of [gamma-33P]ATP B 8.52 pIC50 3 nM IC50 J Med Chem (2019) 62: 4606-4623 [PMID:30943029]
GtoPdb Inhibition of CDK2/cyclin E complex. - 8.7 pIC50 2 nM IC50 J Med Chem (2019) 62: 4606-4623 [PMID:30943029]
GtoPdb - - 9 pIC50 1 nM IC50 ACS Chem Biol (2013) 8: 2360-5 [PMID:24007471]
ChEMBL Inhibition of recombinant CDK2/cyclin A (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated histone H1 as substrate after 1 hr by gamma32P-ATP based liquid scintillation counting analysis B 9 pIC50 1 nM IC50 J Med Chem (2016) 59: 8667-8684 [PMID:27171036]
cyclin dependent kinase 7/CDK7/Cyclin H/MNAT1 in Human (target type: PROTEIN COMPLEX) [ChEMBL: CHEMBL3038473] [GtoPdb: 1979] [UniProtKB: P50613P51946P51948]
ChEMBL Inhibition of CDK7/Cyclin H/MAT1 (unknown origin) using (YSPTSPS)2KK peptide as substrate in presence of [gamma-33P]ATP B 6.77 pIC50 170 nM IC50 Eur J Med Chem (2016) 108: 701-719 [PMID:26741853]
ChEMBL Inhibition of recombinant human N-terminal GST-His6-fused CDK7 (M1 to F346 residues)/N-terminal His-tagged cyclin H (M1 to L323 residues)/N-terminal His6-tagged MAT1 (M1 to S306 residues) expressed in baculovirus infected Sf9 insect cells using (YSPTSPS)2KK as substrate measured in presence of [gamma-33P]ATP B 6.77 pIC50 170 nM IC50 J Med Chem (2019) 62: 4606-4623 [PMID:30943029]
cyclin dependent kinase 9/CDK9/Cyclin T in Human (target type: PROTEIN COMPLEX GROUP) [ChEMBL: CHEMBL5291961] [GtoPdb: 1981] [UniProtKB: O60563O60583P50750]
ChEMBL Inhibition of CDK9/cyclin T (unknown origin) assessed as inhibition constant B 8.4 pKi 4 nM Ki Bioorg Med Chem (2023) 80: 117158-117158 [PMID:36706608]
GtoPdb - - 8.4 pIC50 4 nM IC50 ACS Chem Biol (2013) 8: 2360-5 [PMID:24007471]
cyclin dependent kinase 9/CDK9/cyclin T1 in Human (target type: PROTEIN COMPLEX) [ChEMBL: CHEMBL2111389] [GtoPdb: 1981] [UniProtKB: O60563P50750]
ChEMBL Inhibition of CDK9/Cyclin T1 (unknown origin) using (YSPTSPS)2KK peptide as substrate in presence of [gamma-33P]ATP B 6.75 pIC50 178 nM IC50 Eur J Med Chem (2016) 108: 701-719 [PMID:26741853]
ChEMBL Inhibition of recombinant human N-terminal GST-His6-fused CDK9 (M1 to F372 residues)/N-terminal His6-tagged cyclin T1 (M1 to K726 residues) expressed in baculovirus infected Sf9 insect cells using (YSPTSPS)2KK as substrate measured in presence of [gamma-33P]ATP B 7.82 pIC50 15 nM IC50 J Med Chem (2019) 62: 4606-4623 [PMID:30943029]
ChEMBL Inhibition of GST-tagged human CDK9/Cyclin T1 expressed in Sf9 cells using (YSPTSPS)2KK peptide as substrate in presence of ATP and [gamma33-P] ATP by radioisotope filter binding assay B 8.22 pIC50 6 nM IC50 J Med Chem (2022) 65: 8881-8896 [PMID:35749742]
ChEMBL Inhibition of recombinant full-length N-terminal GST-tagged human CDK9 (1 to 372 residues)/full-length His6-tagged human cyclin T1 (1 to 726 residues) expressed in baculovirus expression system using 5'FAM-RRRFRPASPLRGPPK-COOH as substrate after 30 mins by microfluidic assay B 8.4 pIC50 4 nM IC50 Medchemcomm (2016) 7: 1580-1586 [PMID:27746890]
ChEMBL Inhibition of N-terminal GST-HIS6 fusion protein tagged human full length CDK9 (M1 to F372 residues)/N-terminal GST-HIS6 fusion protein tagged human Cyclin-T1 (M1 to K726 residues) expressed in Sf9 cells at 10 uM using TAMRA-Rbtide substrate and ATP incubated for 1 hr by fluorescent polarization assay B 8.4 pIC50 4 nM IC50 Bioorg Med Chem Lett (2018) 28: 769-773 [PMID:29329658]
ChEMBL Inhibition of recombinant CDK9/cyclin T (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated histone H1 as substrate after 1 hr by gamma32P-ATP based liquid scintillation counting analysis B 8.4 pIC50 4 nM IC50 J Med Chem (2016) 59: 8667-8684 [PMID:27171036]
ChEMBL Inhibition of CDK9/Cyclin T (unknown origin) B 8.4 pIC50 4 nM IC50 J Med Chem (2022) 65: 6390-6418 [PMID:35485642]
GtoPdb - - 8.4 pIC50 4 nM IC50 ACS Chem Biol (2013) 8: 2360-5 [PMID:24007471]
ChEMBL Inhibition of human CDK9/cyclin-T1 using [protein fragment, 39 aa] as substrate incubated for 2 hrs by [gamma-33P]-ATP assay B 8.57 pIC50 2.7 nM IC50 J Med Chem (2021) 64: 12548-12571 [PMID:34415148]
Protein kinase G (PKG) 1/cGMP-dependent protein kinase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4273] [GtoPdb: 1492] [UniProtKB: Q13976]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Choline-phosphate cytidylyltransferase A in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105855] [UniProtKB: P49585]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Chromodomain-helicase-DNA-binding protein 4 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105742] [UniProtKB: Q14839]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 8.52 pKd 3 nM Kd Science (2017) 358: null-null [PMID:29191878]
citron rho-interacting serine/threonine kinase/Citron Rho-interacting kinase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5579] [GtoPdb: 1509] [UniProtKB: O14578]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
cyclin dependent kinase 1/Cyclin-dependent kinase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL308] [GtoPdb: 1961] [UniProtKB: P06493]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 5.92 pKd 1216 nM Kd Science (2017) 358: null-null [PMID:29191878]
ChEMBL Inhibition of CDK1 (unknown origin) B 7.14 pIC50 72 nM IC50 Eur J Med Chem (2016) 110: 291-301 [PMID:26851505]
ChEMBL Inhibition of CDK1 (unknown origin) B 7.3 pIC50 <50 nM IC50 Eur J Med Chem (2024) 275: 116540-116540 [PMID:38852338]
ChEMBL Inhibition of CDK1 (unknown origin) B 7.92 pIC50 12 nM IC50 Eur J Med Chem (2022) 240: 114603-114603 [PMID:35868123]
ChEMBL Inhibition of CDK1 (unknown origin) by FRET assay B 8.27 pIC50 5.32 nM IC50 Eur J Med Chem (2022) 243: 114704-114704 [PMID:36095992]
GtoPdb - - 8.52 pIC50 3 nM IC50 ACS Chem Biol (2013) 8: 2360-5 [PMID:24007471]
ChEMBL Inhibition of recombinant CDK1 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated-histone H1 as substrate incubated for 1 hr in presence of cyclin by [33P]-ATP-based liquid scintillation counting method B 8.52 pIC50 3 nM IC50 J Med Chem (2019) 62: 4233-4251 [PMID:30543440]
ChEMBL Inhibition of recombinant CDK1 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated peptide as substrate after 1 hr in presence of [33P]ATP by TopCount scintillation counting method B 8.52 pIC50 3 nM IC50 Eur J Med Chem (2019) 172: 143-153 [PMID:30978559]
ChEMBL Inhibition of CDK1 (unknown origin) B 8.52 pIC50 3 nM IC50 Eur J Med Chem (2019) 183: 111641-111641 [PMID:31514062]
ChEMBL Inhibition of CDK1 (unknown origin) B 8.52 pIC50 3 nM IC50 J Med Chem (2020) 63: 13228-13257 [PMID:32866383]
ChEMBL Inhibition of recombinant CDK1 (unknown origin) expressed in baculovirus infected Sf9 cells using biotinylated Histone H1 peptide as substrate incubated for 1 hr in presence of [33P]ATP by liquid scintillation counting method B 8.52 pIC50 3 nM IC50 Eur J Med Chem (2021) 215: 113281-113281 [PMID:33611192]
ChEMBL Inhibition of recombinant CDK1 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated Histone H1 as substrate after 1 hr in presence of 33P-ATP by liquid scintillation counting analysis B 8.52 pIC50 3 nM IC50 J Med Chem (2016) 59: 8667-8684 [PMID:27171036]
ChEMBL Inhibition of CDK1 (unknown origin) expressed in baculovirus infected Sf9 insect cells using histone H1 as substrate after 1 hr by liquid scintillation counting analysis B 8.52 pIC50 3 nM IC50 Bioorg Med Chem (2018) 26: 3491-3501 [PMID:29853338]
ChEMBL Inhibition of CDK1 (unknown origin) B 8.52 pIC50 3 nM IC50 Eur J Med Chem (2022) 242: 114701-114701 [PMID:36054949]
ChEMBL Inhibition of CDK1 (unknown origin) B 8.52 pIC50 3 nM IC50 J Med Chem (2024) 67: 5185-5215 [PMID:38564299]
ChEMBL Inhibition of CDK1 (unknown origin) B 8.52 pIC50 3 nM IC50 Nat Rev Drug Discov (2017) 16: 424-440 [PMID:28280261]
ChEMBL Inhibition of CDK1 (unknown origin) B 8.52 pIC50 3 nM IC50 J Med Chem (2022) 65: 935-954 [PMID:33970631]
ChEMBL Inhibition of CDK1 (unknown origin) B 8.52 pIC50 3 nM IC50 RSC Med Chem (2022) 13: 688-710 [PMID:35814933]
ChEMBL Inhibition of CDK1 (unknown origin) B 8.52 pIC50 3 nM IC50 Eur J Med Chem (2020) 203: 112571-112571 [PMID:32707525]
ChEMBL Inhibition of CDK1 (unknown origin) B 8.52 pIC50 3 nM IC50 J Med Chem (2016) 59: 9305-9320 [PMID:27559828]
ChEMBL Inhibition of CDK1 (unknown origin) B 8.52 pIC50 3 nM IC50 J Med Chem (2023) 66: 7140-7161 [PMID:37234044]
ChEMBL Inhibition of recombinant CDK1 (unknown origin) expressed in baculovirus infected Sf9 cells using a histone H1-derived substrate incubated for 1 hr in presence of [33P]ATP by liquid scintillation counter analysis B 8.7 pIC50 2 nM IC50 J Med Chem (2024) 67: 10035-10056 [PMID:38885173]
ChEMBL Inhibition of CDK1 (unknown origin) B 9 pIC50 1 nM IC50 J Med Chem (2022) 65: 893-921 [PMID:33539089]
ChEMBL Inhibition of CDK1 (unknown origin) expressed in Sf9 insect cells using biotinylated peptide derived Histone H1 as substrate incubated for 1 hr in presence of [gamma33P]ATP by liquid scintillation counter method B 9 pIC50 1 nM IC50 J Med Chem (2021) 64: 14647-14663 [PMID:34477384]
cyclin dependent kinase 12/Cyclin-dependent kinase 12 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3559692] [GtoPdb: 1965] [UniProtKB: Q9NYV4]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 7.49 pKd 32 nM Kd Science (2017) 358: null-null [PMID:29191878]
ChEMBL Inhibition of CDK12 (unknown origin) B 7.3 pIC50 50 nM IC50 Eur J Med Chem (2022) 240: 114603-114603 [PMID:35868123]
cyclin dependent kinase 13/Cyclin-dependent kinase 13 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1795192] [GtoPdb: 1966] [UniProtKB: Q14004]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 7.68 pKd 21 nM Kd Science (2017) 358: null-null [PMID:29191878]
cyclin dependent kinase 13/Cyclin-dependent kinase 13/Cyclin-K in Human (target type: PROTEIN COMPLEX) [ChEMBL: CHEMBL4296067] [GtoPdb: 1966] [UniProtKB: O75909Q14004]
ChEMBL Inhibition of GST-tagged human CDK13/Cyclin K expressed in Sf9 cells using RBER-IRStide peptide as substrate in presence of ATP and [gamma33-P] ATP by radioisotope filter binding assay B 7.68 pIC50 21 nM IC50 J Med Chem (2022) 65: 8881-8896 [PMID:35749742]
cyclin dependent kinase 16/Cyclin-dependent kinase 16 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4597] [GtoPdb: 1969] [UniProtKB: Q00536]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 6.9 pKd 125 nM Kd Science (2017) 358: null-null [PMID:29191878]
cyclin dependent kinase 17/Cyclin-dependent kinase 17 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5790] [GtoPdb: 1970] [UniProtKB: Q00537]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 6.11 pKd 778 nM Kd Science (2017) 358: null-null [PMID:29191878]
cyclin dependent kinase 1/Cyclin-dependent kinase 1/cyclin B in Human (target type: PROTEIN COMPLEX) [ChEMBL: CHEMBL2094127] [GtoPdb: 1961] [UniProtKB: O95067P06493P14635Q8WWL7]
ChEMBL Inhibition of CDK1/Cyclin B (unknown origin) assessed as inhibition constant B 8.52 pKi 3 nM Ki Bioorg Med Chem (2023) 80: 117158-117158 [PMID:36706608]
GtoPdb - - 8.52 pIC50 3 nM IC50 ACS Chem Biol (2013) 8: 2360-5 [PMID:24007471]
cyclin dependent kinase 1/Cyclin-dependent kinase 1/cyclin B1 in Human (target type: PROTEIN COMPLEX) [ChEMBL: CHEMBL1907602] [GtoPdb: 1961] [UniProtKB: P06493P14635]
ChEMBL Inhibition of CDK1/Cyclin B (unknown origin) expressed in baculoviral infected insect Sf9 cells using histone H1 as substrate in presence of [gamma-33P]ATP B 7.14 pIC50 72 nM IC50 Eur J Med Chem (2016) 108: 701-719 [PMID:26741853]
ChEMBL Inhibition of His-tagged CDK1/Cyclin-B1 (unknown origin) expressed in baculovirus infected Sf9 insect cells using histone H1 as substrate measured in presence of [gamma-33P]ATP B 7.14 pIC50 72 nM IC50 J Med Chem (2019) 62: 4606-4623 [PMID:30943029]
GtoPdb - - 8.52 pIC50 3 nM IC50 ACS Chem Biol (2013) 8: 2360-5 [PMID:24007471]
ChEMBL Inhibition of recombinant CDK1/cyclin B (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated histone H1 as substrate after 1 hr by gamma32P-ATP based liquid scintillation counting analysis B 8.52 pIC50 3 nM IC50 J Med Chem (2016) 59: 8667-8684 [PMID:27171036]
cyclin dependent kinase 2/Cyclin-dependent kinase 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL301] [GtoPdb: 1973] [UniProtKB: P24941]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 7.05 pKd 90 nM Kd Science (2017) 358: null-null [PMID:29191878]
ChEMBL Binding affinity to CDK2 (unknown origin) by isothermal titration calorimetry B 7.74 pKd 18.4 nM Kd Eur J Med Chem (2021) 216: 113309-113309 [PMID:33711765]
ChEMBL Inhibition of CDK2 (unknown origin) B 7.7 pIC50 20 nM IC50 RSC Med Chem (2023) 14: 734-744 [PMID:37122549]
ChEMBL Inhibition of CDK2 (unknown origin) by western blot assay B 8 pIC50 10 nM IC50 J Med Chem (2021) 64: 2382-2418 [PMID:33650861]
ChEMBL Inhibition of CDK2 (unknown origin) B 8.3 pIC50 <5 nM IC50 Eur J Med Chem (2024) 275: 116540-116540 [PMID:38852338]
ChEMBL Inhibition of CDK2 (unknown origin) by FRET assay B 8.38 pIC50 4.19 nM IC50 Eur J Med Chem (2022) 243: 114704-114704 [PMID:36095992]
ChEMBL Inhibition of CDK2 (unknown origin) B 8.52 pIC50 <3 nM IC50 Eur J Med Chem (2022) 240: 114603-114603 [PMID:35868123]
ChEMBL Inhibition of CDK2 (unknown origin) using ULight 4EBP1 peptide as substrate incubated for 1 hr in presence of ATP by FRET assay B 8.55 pIC50 2.81 nM IC50 J Med Chem (2024) 67: 10035-10056 [PMID:38885173]
GtoPdb Inhibition of CDK2/cyclin E complex. - 8.7 pIC50 2 nM IC50 J Med Chem (2019) 62: 4606-4623 [PMID:30943029]
GtoPdb - - 9 pIC50 1 nM IC50 ACS Chem Biol (2013) 8: 2360-5 [PMID:24007471]
ChEMBL Inhibition of CDK2 (unknown origin) B 9 pIC50 1 nM IC50 J Med Chem (2020) 63: 13228-13257 [PMID:32866383]
ChEMBL Inhibition of recombinant CDK2 (unknown origin) expressed in baculovirus infected Sf9 cells using biotinylated Histone H1 peptide as substrate incubated for 1 hr in presence of [33P]ATP by liquid scintillation counting method B 9 pIC50 1 nM IC50 Eur J Med Chem (2021) 215: 113281-113281 [PMID:33611192]
ChEMBL Inhibition of human CDK2 B 9 pIC50 1 nM IC50 Eur J Med Chem (2021) 218: 113389-113389 [PMID:33784602]
ChEMBL Inhibition of CDK2 (unknown origin) expressed in Sf9 insect cells using biotinylated peptide derived Histone H1 as substrate incubated for 1 hr in presence of [gamma33P]ATP by liquid scintillation counter method B 9 pIC50 1 nM IC50 J Med Chem (2021) 64: 14647-14663 [PMID:34477384]
ChEMBL Inhibition of CDK2 (unknown origin) B 9 pIC50 1 nM IC50 J Med Chem (2022) 65: 893-921 [PMID:33539089]
ChEMBL Inhibition of recombinant CDK2 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated Histone H1 as substrate after 1 hr in presence of 33P-ATP by liquid scintillation counting analysis B 9 pIC50 1 nM IC50 J Med Chem (2016) 59: 8667-8684 [PMID:27171036]
ChEMBL Inhibition of CDK2 (unknown origin) B 9 pIC50 1 nM IC50 Eur J Med Chem (2020) 203: 112571-112571 [PMID:32707525]
ChEMBL Inhibition of CDK2 (unknown origin) B 9 pIC50 1 nM IC50 J Med Chem (2016) 59: 9305-9320 [PMID:27559828]
ChEMBL Inhibition of CDK2 (unknown origin) B 9 pIC50 1 nM IC50 J Med Chem (2023) 66: 7140-7161 [PMID:37234044]
ChEMBL Inhibition of CDK2 (unknown origin) B 9 pIC50 1 nM IC50 Eur J Med Chem (2022) 242: 114701-114701 [PMID:36054949]
ChEMBL Inhibition of recombinant CDK2 (unknown origin) expressed in baculovirus infected Sf9 cells using a histone H1-derived substrate incubated for 1 hr in presence of [33P]ATP by liquid scintillation counter analysis B 9 pIC50 1 nM IC50 J Med Chem (2024) 67: 10035-10056 [PMID:38885173]
ChEMBL Inhibition of CDK2 (unknown origin) B 9 pIC50 1 nM IC50 J Med Chem (2024) 67: 5185-5215 [PMID:38564299]
ChEMBL Inhibition of CDK2 (unknown origin) B 9 pIC50 1 nM IC50 RSC Med Chem (2022) 13: 688-710 [PMID:35814933]
ChEMBL Inhibition of CDK2 (unknown origin) B 9 pIC50 1 nM IC50 Nat Rev Drug Discov (2017) 16: 424-440 [PMID:28280261]
ChEMBL Inhibition of CDK2 (unknown origin) expressed in baculovirus infected Sf9 insect cells using histone H1 as substrate after 1 hr by liquid scintillation counting analysis B 9 pIC50 1 nM IC50 Bioorg Med Chem (2018) 26: 3491-3501 [PMID:29853338]
ChEMBL Inhibition of recombinant CDK2 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated-histone H1 as substrate incubated for 1 hr in presence of cyclin by [33P]-ATP-based liquid scintillation counting method B 9 pIC50 1 nM IC50 J Med Chem (2019) 62: 4233-4251 [PMID:30543440]
ChEMBL Inhibition of recombinant CDK2 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated peptide as substrate after 1 hr in presence of [33P]ATP by TopCount scintillation counting method B 9 pIC50 1 nM IC50 Eur J Med Chem (2019) 172: 143-153 [PMID:30978559]
ChEMBL Inhibition of CDK2 (unknown origin) B 9 pIC50 1 nM IC50 Eur J Med Chem (2019) 183: 111641-111641 [PMID:31514062]
cyclin dependent kinase 2/Cyclin-dependent kinase 2/cyclin E in Human (target type: PROTEIN COMPLEX) [ChEMBL: CHEMBL2094126] [GtoPdb: 1973] [UniProtKB: O96020P24864P24941]
ChEMBL Inhibition of CDK2/cyclin E (unknown origin) assessed as inhibition constant B 9 pKi 1 nM Ki Bioorg Med Chem (2023) 80: 117158-117158 [PMID:36706608]
GtoPdb Inhibition of CDK2/cyclin E complex. - 8.7 pIC50 2 nM IC50 J Med Chem (2019) 62: 4606-4623 [PMID:30943029]
GtoPdb - - 9 pIC50 1 nM IC50 ACS Chem Biol (2013) 8: 2360-5 [PMID:24007471]
cyclin dependent kinase 2/Cyclin-dependent kinase 2/cyclin E1 in Human (target type: PROTEIN COMPLEX) [ChEMBL: CHEMBL1907605] [GtoPdb: 1973] [UniProtKB: P24864P24941]
ChEMBL Inhibition of CDK2/cyclin E (unknown origin) using peptide substrate in presence of [gamma33P]ATP by image analyser B 8.4 pIC50 4 nM IC50 Eur J Med Chem (2021) 216: 113309-113309 [PMID:33711765]
ChEMBL Inhibition of His-tagged CDK2/cyclin E1 (unknown origin) expressed in Sf9 cells using histone H1 as substrate in presence of ATP and [gamma33-P]ATP by radioisotope filter binding assay B 8.52 pIC50 3 nM IC50 J Med Chem (2022) 65: 8881-8896 [PMID:35749742]
ChEMBL Inhibition of CDK2/Cyclin E (unknown origin) expressed in sf9 cells using histone H1 as substrate in presence of [gamma33P]-ATP B 8.7 pIC50 2 nM IC50 Eur J Med Chem (2016) 110: 291-301 [PMID:26851505]
ChEMBL Inhibition of His-tagged CDK2/Cyclin-E1 (unknown origin) expressed in baculovirus infected Sf9 insect cells using histone H1 as substrate measured in presence of [gamma-33P]ATP B 8.7 pIC50 2 nM IC50 J Med Chem (2019) 62: 4606-4623 [PMID:30943029]
GtoPdb Inhibition of CDK2/cyclin E complex. - 8.7 pIC50 2 nM IC50 J Med Chem (2019) 62: 4606-4623 [PMID:30943029]
GtoPdb - - 9 pIC50 1 nM IC50 ACS Chem Biol (2013) 8: 2360-5 [PMID:24007471]
cyclin dependent kinase 2/Cyclin-dependent kinase 2/G1/S-specific cyclin-D1 in Human (target type: PROTEIN COMPLEX) [ChEMBL: CHEMBL3885552] [GtoPdb: 1973] [UniProtKB: P24385P24941]
ChEMBL Inhibition of GST-tagged CDK2/cyclin D1 (unknown origin) expressed in Sf9 cells using RPPTLSPIPHIPR peptide as substrate in presence of ATP and [gamma33-P] ATP by radioisotope filter binding assay B 6.94 pIC50 115 nM IC50 J Med Chem (2022) 65: 8881-8896 [PMID:35749742]
GtoPdb Inhibition of CDK2/cyclin E complex. - 8.7 pIC50 2 nM IC50 J Med Chem (2019) 62: 4606-4623 [PMID:30943029]
GtoPdb - - 9 pIC50 1 nM IC50 ACS Chem Biol (2013) 8: 2360-5 [PMID:24007471]
cyclin dependent kinase 3/Cyclin-dependent kinase 3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4442] [GtoPdb: 1975] [UniProtKB: Q00526]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
cyclin dependent kinase 4/Cyclin-dependent kinase 4 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL331] [GtoPdb: 1976] [UniProtKB: P11802]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 5.94 pKd 1145 nM Kd Science (2017) 358: null-null [PMID:29191878]
ChEMBL Inhibition of CDK4 (unknown origin) B 6.9 pIC50 127 nM IC50 Eur J Med Chem (2016) 110: 291-301 [PMID:26851505]
ChEMBL Inhibition of CDK4 (unknown origin) expressed in Sf9 insect cells incubated for 1 hr in presence of [gamma33P]ATP by liquid scintillation counter method B 9 pIC50 1 nM IC50 J Med Chem (2021) 64: 14647-14663 [PMID:34477384]
ChEMBL Inhibition of CDK4 (unknown origin) B 9 pIC50 1 nM IC50 J Med Chem (2022) 65: 893-921 [PMID:33539089]
cyclin dependent kinase 4/Cyclin-dependent kinase 4/cyclin D1 in Human (target type: PROTEIN COMPLEX) [ChEMBL: CHEMBL1907601] [GtoPdb: 1976] [UniProtKB: P11802P24385]
ChEMBL Inhibition of CDK4/Cyclin D1 (unknown origin) using RPPTLSPIPHIPR peptide as substrate in presence of [gamma-33P]ATP B 6.9 pIC50 127 nM IC50 Eur J Med Chem (2016) 108: 701-719 [PMID:26741853]
ChEMBL Inhibition of recombinant human N-terminal GST-fused CDK4 (S4 to E303 residues)/cyclin D1 (Q4 to I295 residues) expressed in baculovirus infected Sf9 insect cells using RPPTLSPIPHIPR as substrate measured in presence of [gamma-33P]ATP B 6.94 pIC50 115 nM IC50 J Med Chem (2019) 62: 4606-4623 [PMID:30943029]
cyclin dependent kinase 5/Cyclin-dependent kinase 5 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4036] [GtoPdb: 1977] [UniProtKB: Q00535]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 7.04 pKd 91 nM Kd Science (2017) 358: null-null [PMID:29191878]
ChEMBL Inhibition of CDK5 (unknown origin) using histone H1 as substrate in presence of [gamma33P]-ATP B 7.35 pIC50 45 nM IC50 Eur J Med Chem (2016) 110: 291-301 [PMID:26851505]
ChEMBL Inhibition of CDK5 (unknown origin) B 8.3 pIC50 <5 nM IC50 Eur J Med Chem (2024) 275: 116540-116540 [PMID:38852338]
ChEMBL Inhibition of CDK5 (unknown origin) B 8.3 pIC50 5 nM IC50 RSC Med Chem (2022) 13: 688-710 [PMID:35814933]
ChEMBL Inhibition of CDK5 (unknown origin) by FRET assay B 8.68 pIC50 2.09 nM IC50 Eur J Med Chem (2022) 243: 114704-114704 [PMID:36095992]
GtoPdb - - 9 pIC50 1 nM IC50 ACS Chem Biol (2013) 8: 2360-5 [PMID:24007471]
ChEMBL Inhibition of recombinant CDK5 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated-histone H1 as substrate incubated for 1 hr in presence of cyclin by [33P]-ATP-based liquid scintillation counting method B 9 pIC50 1 nM IC50 J Med Chem (2019) 62: 4233-4251 [PMID:30543440]
ChEMBL Inhibition of recombinant CDK5 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated peptide as substrate after 1 hr in presence of [33P]ATP by TopCount scintillation counting method B 9 pIC50 1 nM IC50 Eur J Med Chem (2019) 172: 143-153 [PMID:30978559]
ChEMBL Inhibition of CDK5 (unknown origin) B 9 pIC50 1 nM IC50 Eur J Med Chem (2019) 183: 111641-111641 [PMID:31514062]
ChEMBL Inhibition of CDK5 (unknown origin) B 9 pIC50 1 nM IC50 J Med Chem (2020) 63: 13228-13257 [PMID:32866383]
ChEMBL Inhibition of recombinant CDK5 (unknown origin) expressed in baculovirus infected Sf9 cells using biotinylated Histone H1 peptide as substrate incubated for 1 hr in presence of [33P]ATP by liquid scintillation counting method B 9 pIC50 1 nM IC50 Eur J Med Chem (2021) 215: 113281-113281 [PMID:33611192]
ChEMBL Inhibition of CDK5 (unknown origin) expressed in Sf9 insect cells using biotinylated peptide derived Histone H1 as substrate incubated for 1 hr in presence of [gamma33P]ATP by liquid scintillation counter method B 9 pIC50 1 nM IC50 J Med Chem (2021) 64: 14647-14663 [PMID:34477384]
ChEMBL Inhibition of Cdk5 (unknown origin) B 9 pIC50 1 nM IC50 J Med Chem (2022) 65: 893-921 [PMID:33539089]
ChEMBL Inhibition of recombinant CDK5 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated Histone H1 as substrate after 1 hr in presence of 33P-ATP by liquid scintillation counting analysis B 9 pIC50 1 nM IC50 J Med Chem (2016) 59: 8667-8684 [PMID:27171036]
ChEMBL Inhibition of CDK5 (unknown origin) B 9 pIC50 1 nM IC50 Eur J Med Chem (2020) 203: 112571-112571 [PMID:32707525]
ChEMBL Inhibition of CDK5 (unknown origin) B 9 pIC50 1 nM IC50 J Med Chem (2016) 59: 9305-9320 [PMID:27559828]
ChEMBL Inhibition of CDK5 (unknown origin) B 9 pIC50 1 nM IC50 J Med Chem (2023) 66: 7140-7161 [PMID:37234044]
ChEMBL Inhibition of CDK5 (unknown origin) B 9 pIC50 1 nM IC50 Eur J Med Chem (2022) 242: 114701-114701 [PMID:36054949]
ChEMBL Inhibition of recombinant CDK5 (unknown origin) expressed in baculovirus infected Sf9 cells using a histone H1-derived substrate incubated for 1 hr in presence of [33P]ATP by liquid scintillation counter analysis B 9 pIC50 1 nM IC50 J Med Chem (2024) 67: 10035-10056 [PMID:38885173]
ChEMBL Inhibition of CDK5 (unknown origin) B 9 pIC50 1 nM IC50 J Med Chem (2024) 67: 5185-5215 [PMID:38564299]
ChEMBL Inhibition of CDK5 (unknown origin) expressed in baculovirus infected Sf9 insect cells using histone H1 as substrate after 1 hr by liquid scintillation counting analysis B 9 pIC50 1 nM IC50 Bioorg Med Chem (2018) 26: 3491-3501 [PMID:29853338]
ChEMBL Inhibition of CDK5 (unknown origin) B 9 pIC50 1 nM IC50 Nat Rev Drug Discov (2017) 16: 424-440 [PMID:28280261]
cyclin dependent kinase 5/Cyclin-dependent kinase 5/CDK5 activator 1 in Human (target type: PROTEIN COMPLEX) [ChEMBL: CHEMBL1907600] [GtoPdb: 1977] [UniProtKB: Q00535Q15078]
ChEMBL Inhibition of recombinant human full-length N-terminal GST-His6 fused CDK5 (M1 to P292 residues)/N-terminal His6-tagged p25 (A104 to R307 residues) expressed in baculovirus infected Sf9 insect cells using histone H1 as substrate measured in presence of [gamma-33P]ATP B 7.17 pIC50 67 nM IC50 J Med Chem (2019) 62: 4606-4623 [PMID:30943029]
ChEMBL Inhibition of CDK5/p25 (unknown origin) B 7.26 pIC50 55 nM IC50 Eur J Med Chem (2023) 260: 115756-115756 [PMID:37657272]
ChEMBL Inhibition of CDK5/p35NCK (unknown origin) using histone H1 as substrate in presence of [gamma-33P]ATP B 7.35 pIC50 45 nM IC50 Eur J Med Chem (2016) 108: 701-719 [PMID:26741853]
ChEMBL Inhibition of Nano-Luc fused human full length CDK5/P35 transfected in HEK293 cells incubated for 1 hr by NanoBRET assay B 7.8 pIC50 16 nM IC50 J Med Chem (2022) 65: 3575-3596 [PMID:35143203]
ChEMBL Inhibition of full length N-terminal GST fused human CDK5(1 to 292 residues)/ p25 (99 to 307 residues) expressed in baculovirus expression system using FL peptide as substrate preincubated for 30 mins followed by substrate addition further incubated for 60 mins by EZ reader method B 8.8 pIC50 1.6 nM IC50 J Med Chem (2022) 65: 3575-3596 [PMID:35143203]
GtoPdb - - 9 pIC50 1 nM IC50 ACS Chem Biol (2013) 8: 2360-5 [PMID:24007471]
ChEMBL Inhibition of CDK5/p35 (unknown origin) B 9 pIC50 1 nM IC50 J Med Chem (2022) 65: 6390-6418 [PMID:35485642]
ChEMBL Inhibition of recombinant CDK5/p25 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated histone H1 as substrate after 1 hr by gamma32P-ATP based liquid scintillation counting analysis B 9 pIC50 1 nM IC50 J Med Chem (2016) 59: 8667-8684 [PMID:27171036]
cyclin dependent kinase 6/Cyclin-dependent kinase 6 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2508] [GtoPdb: 1978] [UniProtKB: Q00534]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 7.49 pKd 32 nM Kd Science (2017) 358: null-null [PMID:29191878]
cyclin dependent kinase 7/Cyclin-dependent kinase 7 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3055] [GtoPdb: 1979] [UniProtKB: P50613]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 6.39 pKd 411 nM Kd Science (2017) 358: null-null [PMID:29191878]
ChEMBL Inhibition of CDK7 (unknown origin) B 7.38 pIC50 42 nM IC50 Eur J Med Chem (2022) 240: 114603-114603 [PMID:35868123]
cyclin dependent kinase 8/Cyclin-dependent kinase 8 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5719] [GtoPdb: 1980] [UniProtKB: P49336]
ChEMBL Inhibition of CDK8 in TNF-alpha-induced HEK293 cells by NF-kappaB reporter assay B 8.35 pIC50 4.5 nM IC50 US-20200062728-A1. Quinoline-based compounds and methods of inhibiting cdk8/19 (2020)
ChEMBL Inhibition of CDK8 in TNF-alpha-induced CDK8 and CDK19-knockout HEK293 cells by NF-kappaB reporter assay B 8.47 pIC50 3.4 nM IC50 US-20200062728-A1. Quinoline-based compounds and methods of inhibiting cdk8/19 (2020)
cyclin dependent kinase 9/Cyclin-dependent kinase 9 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3116] [GtoPdb: 1981] [UniProtKB: P50750]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 8.15 pKd 7 nM Kd Science (2017) 358: null-null [PMID:29191878]
ChEMBL Inhibition of CDK9 (unknown origin) B 6.75 pIC50 178 nM IC50 Eur J Med Chem (2016) 110: 291-301 [PMID:26851505]
ChEMBL Inhibition of CDK9 (unknown origin) using ULight 4EBP1 peptide as substrate incubated for 1 hr in presence of ATP by FRET assay B 7.97 pIC50 10.64 nM IC50 J Med Chem (2024) 67: 10035-10056 [PMID:38885173]
ChEMBL Inhibition of CDK9 (unknown origin) B 8.3 pIC50 <5 nM IC50 Eur J Med Chem (2024) 275: 116540-116540 [PMID:38852338]
ChEMBL Inhibition of recombinant CDK9 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated Histone H1 as substrate after 1 hr in presence of 33P-ATP by liquid scintillation counting analysis B 8.4 pIC50 4 nM IC50 J Med Chem (2016) 59: 8667-8684 [PMID:27171036]
ChEMBL Inhibition of recombinant CDK9 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated-histone H1 as substrate incubated for 1 hr in presence of cyclin by [33P]-ATP-based liquid scintillation counting method B 8.4 pIC50 4 nM IC50 J Med Chem (2019) 62: 4233-4251 [PMID:30543440]
ChEMBL Inhibition of recombinant CDK9 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated peptide as substrate after 1 hr in presence of [33P]ATP by TopCount scintillation counting method B 8.4 pIC50 4 nM IC50 Eur J Med Chem (2019) 172: 143-153 [PMID:30978559]
ChEMBL Inhibition of CDK9 (unknown origin) B 8.4 pIC50 4 nM IC50 Eur J Med Chem (2019) 183: 111641-111641 [PMID:31514062]
ChEMBL Inhibition of CDK9 (unknown origin) B 8.4 pIC50 4 nM IC50 J Med Chem (2020) 63: 13228-13257 [PMID:32866383]
ChEMBL Inhibition of recombinant CDK9 (unknown origin) expressed in baculovirus infected Sf9 cells using biotinylated Histone H1 peptide as substrate incubated for 1 hr in presence of [33P]ATP by liquid scintillation counting method B 8.4 pIC50 4 nM IC50 Eur J Med Chem (2021) 215: 113281-113281 [PMID:33611192]
ChEMBL Inhibition of CDK9 (unknown origin) by ADP-Glo kinase assay B 8.4 pIC50 4 nM IC50 J Med Chem (2024) 67: 5185-5215 [PMID:38564299]
ChEMBL Inhibition of CDK9 (unknown origin) expressed in baculovirus infected Sf9 insect cells using histone H1 as substrate after 1 hr by liquid scintillation counting analysis B 8.4 pIC50 4 nM IC50 Bioorg Med Chem (2018) 26: 3491-3501 [PMID:29853338]
ChEMBL Inhibition of CDK9 (unknown origin) B 8.4 pIC50 4 nM IC50 RSC Med Chem (2022) 13: 688-710 [PMID:35814933]
ChEMBL Inhibition of CDK9 (unknown origin) B 8.4 pIC50 4 nM IC50 Eur J Med Chem (2020) 203: 112571-112571 [PMID:32707525]
ChEMBL Inhibition of CDK9 (unknown origin) B 8.4 pIC50 4 nM IC50 J Med Chem (2016) 59: 9305-9320 [PMID:27559828]
ChEMBL Inhibition of CDK9 (unknown origin) B 8.4 pIC50 4 nM IC50 J Med Chem (2023) 66: 7140-7161 [PMID:37234044]
ChEMBL Inhibition of CDK9 (unknown origin) B 8.4 pIC50 4 nM IC50 Eur J Med Chem (2022) 242: 114701-114701 [PMID:36054949]
ChEMBL Inhibition of recombinant CDK9 (unknown origin) expressed in baculovirus infected Sf9 cells using a histone H1-derived substrate incubated for 1 hr in presence of [33P]ATP by liquid scintillation counter analysis B 8.4 pIC50 4 nM IC50 J Med Chem (2024) 67: 10035-10056 [PMID:38885173]
ChEMBL Inhibition of CDK9 (unknown origin) B 8.4 pIC50 4 nM IC50 Nat Rev Drug Discov (2017) 16: 424-440 [PMID:28280261]
GtoPdb - - 8.4 pIC50 4 nM IC50 ACS Chem Biol (2013) 8: 2360-5 [PMID:24007471]
ChEMBL Inhibition of CDK9 (unknown origin) B 8.52 pIC50 <3 nM IC50 Eur J Med Chem (2022) 240: 114603-114603 [PMID:35868123]
ChEMBL Inhibition of CDK9 (unknown origin) expressed in Sf9 insect cells using biotinylated peptide derived Histone H1 as substrate incubated for 1 hr in presence of [gamma33P]ATP by liquid scintillation counter method B 9 pIC50 1 nM IC50 J Med Chem (2021) 64: 14647-14663 [PMID:34477384]
cyclin-dependent kinase like 5/Cyclin-dependent kinase-like 5 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1163112] [GtoPdb: 1986] [UniProtKB: O76039]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
cyclin G associated kinase/Cyclin-G-associated kinase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4355] [GtoPdb: 2027] [UniProtKB: O14976]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Cysteine--tRNA ligase, cytoplasmic in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105937] [UniProtKB: P49589]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Cytochrome c1, heme protein, mitochondrial in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105975] [UniProtKB: P08574]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
dCTP pyrophosphatase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3769292] [UniProtKB: Q9H773]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Delta(24)-sterol reductase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2331059] [UniProtKB: Q15392]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Deoxycytidine kinase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2447] [UniProtKB: P27707]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
discoidin domain receptor tyrosine kinase 2/Discoidin domain-containing receptor 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5122] [GtoPdb: 1844] [UniProtKB: Q16832]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
DnaJ homolog subfamily A member 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2189122] [UniProtKB: P31689]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
DNA replication licensing factor MCM4 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105745] [UniProtKB: P33991]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
DNA topoisomerase II alpha/DNA topoisomerase 2-alpha in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1806] [GtoPdb: 2637] [UniProtKB: P11388]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
DNA topoisomerase 2-beta in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3396] [UniProtKB: Q02880]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase kinase 1/Dual specificity mitogen-activated protein kinase kinase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3587] [GtoPdb: 2062] [UniProtKB: Q02750]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase kinase 2/Dual specificity mitogen-activated protein kinase kinase 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2964] [GtoPdb: 2063] [UniProtKB: P36507]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase kinase 3/Dual specificity mitogen-activated protein kinase kinase 3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2109] [GtoPdb: 2064] [UniProtKB: P46734]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase kinase 4/Dual specificity mitogen-activated protein kinase kinase 4 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2897] [GtoPdb: 2065] [UniProtKB: P45985]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase kinase 5/Dual specificity mitogen-activated protein kinase kinase 5 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4948] [GtoPdb: 2066] [UniProtKB: Q13163]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase kinase 6/Dual specificity mitogen-activated protein kinase kinase 6 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2171] [GtoPdb: 2067] [UniProtKB: P52564]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
CDC like kinase 1/Dual specificity protein kinase CLK1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4224] [GtoPdb: 1990] [UniProtKB: P49759]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 6.15 pKd 714 nM Kd Science (2017) 358: null-null [PMID:29191878]
CDC like kinase 2/Dual specificity protein kinase CLK2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4225] [GtoPdb: 1991] [UniProtKB: P49760]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
CDC like kinase 4/Dual specificity protein kinase CLK4 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4203] [GtoPdb: 1993] [UniProtKB: Q9HAZ1]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
testis associated actin remodelling kinase 1/Dual specificity testis-specific protein kinase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5604] [GtoPdb: 2239] [UniProtKB: Q15569]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
testis associated actin remodelling kinase 2/Dual specificity testis-specific protein kinase 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2069163] [GtoPdb: 2240] [UniProtKB: Q96S53]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
dual specificity tyrosine phosphorylation regulated kinase 1A/Dual specificity tyrosine-phosphorylation-regulated kinase 1A in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2292] [GtoPdb: 2009] [UniProtKB: Q13627]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Dynamin-like GTPase OPA1, mitochondrial in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105705] [UniProtKB: O60313]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
TP53 regulating kinase/EKC/KEOPS complex subunit TP53RK in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1938223] [GtoPdb: 2248] [UniProtKB: Q96S44]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Electron transfer flavoprotein subunit beta in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105744] [UniProtKB: P38117]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Elongation factor Tu, mitochondrial in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105970] [UniProtKB: P49411]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
EPH receptor A1/Ephrin type-A receptor 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5810] [GtoPdb: 1821] [UniProtKB: P21709]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
EPH receptor A2/Ephrin type-A receptor 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2068] [GtoPdb: 1822] [UniProtKB: P29317]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
EPH receptor A4/Ephrin type-A receptor 4 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3988] [GtoPdb: 1824] [UniProtKB: P54764]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
EPH receptor A5/Ephrin type-A receptor 5 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3987] [GtoPdb: 1825] [UniProtKB: P54756]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
EPH receptor A7/Ephrin type-A receptor 7 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4602] [GtoPdb: 1827] [UniProtKB: Q15375]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
EPH receptor B2/Ephrin type-B receptor 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3290] [GtoPdb: 1831] [UniProtKB: P29323]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
EPH receptor B3/Ephrin type-B receptor 3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4901] [GtoPdb: 1832] [UniProtKB: P54753]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
EPH receptor B4/Ephrin type-B receptor 4 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5147] [GtoPdb: 1833] [UniProtKB: P54760]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
EPH receptor B6/Ephrin type-B receptor 6 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5836] [GtoPdb: 1834] [UniProtKB: O15197]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
epidermal growth factor receptor/Epidermal growth factor receptor in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL203] [GtoPdb: 1797] [UniProtKB: P00533]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
discoidin domain receptor tyrosine kinase 1/Epithelial discoidin domain-containing receptor 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5319] [GtoPdb: 1843] [UniProtKB: Q08345]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
eukaryotic translation initiation factor 2 alpha kinase 1/Eukaryotic translation initiation factor 2-alpha kinase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL6029] [GtoPdb: 2015] [UniProtKB: Q9BQI3]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Eukaryotic translation initiation factor 5B in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105852] [UniProtKB: O60841]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Exosome RNA helicase MTR4 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105889] [UniProtKB: P42285]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Ferrochelatase, mitochondrial in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3879831] [UniProtKB: P22830]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
fibroblast growth factor receptor 1/Fibroblast growth factor receptor 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3650] [GtoPdb: 1808] [UniProtKB: P11362]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein tyrosine kinase 2/Focal adhesion kinase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2695] [GtoPdb: 2180] [UniProtKB: Q05397]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
General transcription and DNA repair factor IIH helicase subunit XPD in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105743] [UniProtKB: P18074]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 6.25 pKd 560 nM Kd Science (2017) 358: null-null [PMID:29191878]
Glycine--tRNA ligase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105815] [UniProtKB: P41250]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Glycogen phosphorylase, brain form in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3856] [UniProtKB: P11216]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Glycogen phosphorylase, liver form in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2568] [UniProtKB: P06737]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
glycogen synthase kinase 3 alpha/Glycogen synthase kinase-3 alpha in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2850] [GtoPdb: 2029] [UniProtKB: P49840]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 5.83 pKd 1475 nM Kd Science (2017) 358: null-null [PMID:29191878]
ChEMBL Inhibition of human GSK3A using YRRAAVPPSPSLSRHSSPHQ(pS)EDEEE as substrate incubated for 2 hrs by [gamma-33P]-ATP assay B 6.38 pIC50 414 nM IC50 J Med Chem (2021) 64: 12548-12571 [PMID:34415148]
glycogen synthase kinase 3 beta/Glycogen synthase kinase-3 beta in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL262] [GtoPdb: 2030] [UniProtKB: P49841]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 5.84 pKd 1430 nM Kd Science (2017) 358: null-null [PMID:29191878]
ChEMBL Inhibition of human GSK3B using YRRAAVPPSPSLSRHSSPHQ(pS)EDEEE as substrate incubated for 2 hrs by [gamma-33P]-ATP assay B 6.49 pIC50 324 nM IC50 J Med Chem (2021) 64: 12548-12571 [PMID:34415148]
G protein-coupled receptor kinase 6 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL6144] [GtoPdb: 1470] [UniProtKB: P43250]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
GTP-binding nuclear protein Ran in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1741190] [UniProtKB: P62826]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
GTP-binding protein 4 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105780] [UniProtKB: Q9BZE4]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Guanine nucleotide-binding protein G(i) subunit alpha-2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105887] [UniProtKB: P04899]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Heat shock factor protein 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5869] [UniProtKB: Q00613]
ChEMBL Inhibition of 17AAG-induced HSF1-mediated HSP72 expression in human U2OS cells preincubated for 1 hr followed by 17AAG addition measured after 18 hrs by ELISA B 8.15 pIC50 7 nM IC50 Medchemcomm (2016) 7: 1580-1586 [PMID:27746890]
Haem oxygenase 2/Heme oxygenase 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2546] [GtoPdb: 1442] [UniProtKB: P30519]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
MET proto-oncogene, receptor tyrosine kinase/Hepatocyte growth factor receptor in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3717] [GtoPdb: 1815] [UniProtKB: P08581]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
neurotrophic receptor tyrosine kinase 1/High affinity nerve growth factor receptor in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2815] [GtoPdb: 1817] [UniProtKB: P04629]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
inhibitor of nuclear factor kappa B kinase subunit epsilon/Inhibitor of nuclear factor kappa-B kinase subunit epsilon in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3529] [GtoPdb: 2040] [UniProtKB: Q14164]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
inosine monophosphate dehydrogenase 2/Inosine-5`-monophosphate dehydrogenase 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2002] [GtoPdb: 2625] [UniProtKB: P12268]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Insulin-like growth factor I receptor/Insulin-like growth factor 1 receptor in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1957] [GtoPdb: 1801] [UniProtKB: P08069]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Insulin receptor in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1981] [GtoPdb: 1800] [UniProtKB: P06213]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
integrin linked kinase/Integrin-linked protein kinase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5247] [GtoPdb: 2041] [UniProtKB: Q13418]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
interleukin 1 receptor associated kinase 1/Interleukin-1 receptor-associated kinase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3357] [GtoPdb: 2042] [UniProtKB: P51617]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
interleukin 1 receptor associated kinase 3/Interleukin-1 receptor-associated kinase 3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5081] [GtoPdb: 2044] [UniProtKB: Q9Y616]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
interleukin 1 receptor associated kinase 4/Interleukin-1 receptor-associated kinase 4 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3778] [GtoPdb: 2045] [UniProtKB: Q9NWZ3]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Isoleucine--tRNA ligase, mitochondrial in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105821] [UniProtKB: Q9NSE4]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
LIM domain kinase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3836] [GtoPdb: 2054] [UniProtKB: P53667]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
LIM domain kinase 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5932] [GtoPdb: 2055] [UniProtKB: P53671]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Long-chain-fatty-acid--CoA ligase 5 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105818] [UniProtKB: Q9ULC5]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
macrophage stimulating 1 receptor/Macrophage-stimulating protein receptor in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2689] [GtoPdb: 1816] [UniProtKB: Q04912]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
MAPK activated protein kinase 2/MAP kinase-activated protein kinase 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2208] [GtoPdb: 2094] [UniProtKB: P49137]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
MAPK activated protein kinase 5/MAP kinase-activated protein kinase 5 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3094] [GtoPdb: 2096] [UniProtKB: Q8IW41]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
microtubule affinity regulating kinase 3/MAP/microtubule affinity-regulating kinase 3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5600] [GtoPdb: 2099] [UniProtKB: P27448]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
microtubule affinity regulating kinase 4/MAP/microtubule affinity-regulating kinase 4 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5754] [GtoPdb: 2100] [UniProtKB: Q96L34]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
maternal embryonic leucine zipper kinase/Maternal embryonic leucine zipper kinase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4578] [GtoPdb: 2102] [UniProtKB: Q14680]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Membrane-associated progesterone receptor component 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105706] [UniProtKB: O00264]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein kinase, membrane associated tyrosine/threonine 1/Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3984] [GtoPdb: 2167] [UniProtKB: Q99640]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Midasin in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105779] [UniProtKB: Q9NU22]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
misshapen like kinase 1/Misshapen-like kinase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5518] [GtoPdb: 2103] [UniProtKB: Q8N4C8]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase 1/Mitogen-activated protein kinase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4040] [GtoPdb: 1495] [UniProtKB: P28482]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase 10/Mitogen-activated protein kinase 10 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2637] [GtoPdb: 1498] [UniProtKB: P53779]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase 11/Mitogen-activated protein kinase 11 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3961] [GtoPdb: 1500] [UniProtKB: Q15759]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase 14/Mitogen-activated protein kinase 14 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL260] [GtoPdb: 1499] [UniProtKB: Q16539]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase 15/Mitogen-activated protein kinase 15 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5198] [GtoPdb: 2090] [UniProtKB: Q8TD08]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase 3/Mitogen-activated protein kinase 3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3385] [GtoPdb: 1494] [UniProtKB: P27361]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase 7/Mitogen-activated protein kinase 7 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5332] [GtoPdb: 2093] [UniProtKB: Q13164]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase 8/Mitogen-activated protein kinase 8 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2276] [GtoPdb: 1496] [UniProtKB: P45983]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase 9/Mitogen-activated protein kinase 9 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4179] [GtoPdb: 1497] [UniProtKB: P45984]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase kinase kinase 1/Mitogen-activated protein kinase kinase kinase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3956] [GtoPdb: 2069] [UniProtKB: Q13233]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase kinase kinase 11/Mitogen-activated protein kinase kinase kinase 11 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2708] [GtoPdb: 2071] [UniProtKB: Q16584]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase kinase kinase 2/Mitogen-activated protein kinase kinase kinase 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5914] [GtoPdb: 2077] [UniProtKB: Q9Y2U5]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
ZAK sterile alpha motif and leucine zipper containing kinase AZK/Mitogen-activated protein kinase kinase kinase 20 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3886] [GtoPdb: 2289] [UniProtKB: Q9NYL2]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase kinase kinase 3/Mitogen-activated protein kinase kinase kinase 3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5970] [GtoPdb: 2078] [UniProtKB: Q99759]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase kinase kinase 4/Mitogen-activated protein kinase kinase kinase 4 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4853] [GtoPdb: 2079] [UniProtKB: Q9Y6R4]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase kinase kinase 5/Mitogen-activated protein kinase kinase kinase 5 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5285] [GtoPdb: 2080] [UniProtKB: Q99683]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase kinase kinase 6/Mitogen-activated protein kinase kinase kinase 6 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1163123] [GtoPdb: 2081] [UniProtKB: O95382]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase kinase kinase kinase 1/Mitogen-activated protein kinase kinase kinase kinase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5749] [GtoPdb: 2085] [UniProtKB: Q92918]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase kinase kinase kinase 2/Mitogen-activated protein kinase kinase kinase kinase 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5330] [GtoPdb: 2086] [UniProtKB: Q12851]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase kinase kinase kinase 3/Mitogen-activated protein kinase kinase kinase kinase 3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5432] [GtoPdb: 2087] [UniProtKB: Q8IVH8]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase kinase kinase kinase 4/Mitogen-activated protein kinase kinase kinase kinase 4 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL6166] [GtoPdb: 2088] [UniProtKB: O95819]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
mitogen-activated protein kinase kinase kinase kinase 5/Mitogen-activated protein kinase kinase kinase kinase 5 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4852] [GtoPdb: 2089] [UniProtKB: Q9Y4K4]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
BUB1 mitotic checkpoint serine/threonine kinase/Mitotic checkpoint serine/threonine-protein kinase BUB1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1772932] [GtoPdb: 1949] [UniProtKB: O43683]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Myosin-10 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105746] [UniProtKB: P35580]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Myosin-14 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105888] [UniProtKB: Q7Z406]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
myosin light chain kinase 3/Myosin light chain kinase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4627] [GtoPdb: 2110] [UniProtKB: Q32MK0]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
myosin light chain kinase/Myosin light chain kinase, smooth muscle in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2428] [GtoPdb: 1552] [UniProtKB: Q15746]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105781] [UniProtKB: Q9P0J0]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
tyrosine kinase non receptor 1/Non-receptor tyrosine-protein kinase TNK1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5334] [GtoPdb: 2245] [UniProtKB: Q13470]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
tyrosine kinase 2/Non-receptor tyrosine-protein kinase TYK2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3553] [GtoPdb: 2269] [UniProtKB: P29597]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
NUAK family, SNF1-like kinase, 2/NUAK family SNF1-like kinase 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5698] [GtoPdb: 2130] [UniProtKB: Q9H093]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Obg-like ATPase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105704] [UniProtKB: Q9NTK5]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
PAS domain containing serine/threonine kinase/PAS domain-containing serine/threonine-protein kinase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL6054] [GtoPdb: 2139] [UniProtKB: Q96RG2]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Peroxisomal acyl-coenzyme A oxidase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105748] [UniProtKB: Q15067]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Peroxisomal acyl-coenzyme A oxidase 3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105817] [UniProtKB: O15254]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Phenylalanine--tRNA ligase beta subunit in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105969] [UniProtKB: Q9NSD9]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Phosphatidylethanolamine-binding protein 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105856] [UniProtKB: P30086]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
phosphatidylinositol-5-phosphate 4-kinase type 2 alpha/Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1795194] [GtoPdb: 2858] [UniProtKB: P48426]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
phosphatidylinositol-5-phosphate 4-kinase type 2 gamma/Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1770034] [GtoPdb: 2163] [UniProtKB: Q8TBX8]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
phosphorylase kinase catalytic subunit gamma 2/Phosphorylase b kinase gamma catalytic chain, liver/testis isoform in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2349] [GtoPdb: 2147] [UniProtKB: P15735]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
platelet derived growth factor receptor beta/Platelet-derived growth factor receptor beta in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1913] [GtoPdb: 1804] [UniProtKB: P09619]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Probable ATP-dependent RNA helicase DDX6 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105783] [UniProtKB: P26196]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein kinase C alpha/Protein kinase C alpha type in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL299] [GtoPdb: 1482] [UniProtKB: P17252]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein kinase C beta/Protein kinase C beta type in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3045] [GtoPdb: 1483] [UniProtKB: P05771]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein kinase C delta/Protein kinase C delta type in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2996] [GtoPdb: 1485] [UniProtKB: Q05655]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein kinase C iota/Protein kinase C iota type in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2598] [GtoPdb: 1490] [UniProtKB: P41743]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein kinase C theta/Protein kinase C theta type in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3920] [GtoPdb: 1488] [UniProtKB: Q04759]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein kinase C zeta/Protein kinase C zeta type in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3438] [GtoPdb: 1491] [UniProtKB: Q05513]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein tyrosine kinase 2 beta/Protein-tyrosine kinase 2-beta in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5469] [GtoPdb: 2181] [UniProtKB: Q14289]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein tyrosine kinase 6/Protein-tyrosine kinase 6 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4601] [GtoPdb: 2182] [UniProtKB: Q13882]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
ret proto-oncogene/Proto-oncogene tyrosine-protein kinase receptor Ret in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2041] [GtoPdb: 2185] [UniProtKB: P07949]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
SRC proto-oncogene, non-receptor tyrosine kinase/Proto-oncogene tyrosine-protein kinase Src in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL267] [GtoPdb: 2206] [UniProtKB: P12931]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Putative heat shock protein HSP 90-beta 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105858] [UniProtKB: Q58FF8]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Pyridoxal kinase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1075181] [UniProtKB: O00764]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Rab-like protein 3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105853] [UniProtKB: Q5HYI8]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
AKT serine/threonine kinase 1/RAC-alpha serine/threonine-protein kinase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4282] [GtoPdb: 1479] [UniProtKB: P31749]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
AKT serine/threonine kinase 2/RAC-beta serine/threonine-protein kinase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2431] [GtoPdb: 1480] [UniProtKB: P31751]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
AKT serine/threonine kinase 3/RAC-gamma serine/threonine-protein kinase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4816] [GtoPdb: 2286] [UniProtKB: Q9Y243]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Ras-related protein Rab-10 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105971] [UniProtKB: P61026]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
RAB27A, member RAS oncogene family/Ras-related protein Rab-27A in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105702] [GtoPdb: 2916] [UniProtKB: P51159]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Ras-related protein Rab-6A in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105703] [UniProtKB: P20340]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
receptor interacting serine/threonine kinase 2/Receptor-interacting serine/threonine-protein kinase 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5014] [GtoPdb: 2190] [UniProtKB: O43353]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
receptor interacting serine/threonine kinase 3/Receptor-interacting serine/threonine-protein kinase 3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1795199] [GtoPdb: 2191] [UniProtKB: Q9Y572]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
fms related receptor tyrosine kinase 3/Receptor-type tyrosine-protein kinase FLT3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1974] [GtoPdb: 1807] [UniProtKB: P36888]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
ChEMBL Inhibition of human FLT3 ITD mutant using EAIYAAPFAKKK as substrate preincubated for 20 mins followed by 33P-ATP addition and measured after 2 hrs by filter binding method B 5.7 pIC50 >2000 nM IC50 J Med Chem (2021) 64: 10981-10996 [PMID:34288692]
Rho associated coiled-coil containing protein kinase 1/Rho-associated protein kinase 1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3231] [GtoPdb: 1503] [UniProtKB: Q13464]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Rho associated coiled-coil containing protein kinase 2/Rho-associated protein kinase 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2973] [GtoPdb: 1504] [UniProtKB: O75116]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
ribosomal protein S6 kinase A1/Ribosomal protein S6 kinase alpha-1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2553] [GtoPdb: 1527] [UniProtKB: Q15418]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
ribosomal protein S6 kinase A3/Ribosomal protein S6 kinase alpha-3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2345] [GtoPdb: 1528] [UniProtKB: P51812]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
ribosomal protein S6 kinase A4/Ribosomal protein S6 kinase alpha-4 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3125] [GtoPdb: 1524] [UniProtKB: O75676]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
ribosomal protein S6 kinase A5/Ribosomal protein S6 kinase alpha-5 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4237] [GtoPdb: 1523] [UniProtKB: O75582]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
ribosomal protein S6 kinase A6/Ribosomal protein S6 kinase alpha-6 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4924] [GtoPdb: 1530] [UniProtKB: Q9UK32]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
ribosomal protein S6 kinase B1/Ribosomal protein S6 kinase beta-1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4501] [GtoPdb: 1525] [UniProtKB: P23443]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Ribosyldihydronicotinamide dehydrogenase [quinone] in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3959] [UniProtKB: P16083]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
RNA cytidine acetyltransferase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105935] [UniProtKB: Q9H0A0]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
methionine adenosyltransferase 2A/S-adenosylmethionine synthase isoform type-2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3313835] [GtoPdb: 3341] [UniProtKB: P31153]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Septin-9 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105891] [UniProtKB: Q9UHD8]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
serine/threonine kinase 10/Serine/threonine-protein kinase 10 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3981] [GtoPdb: 2211] [UniProtKB: O94804]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
serine/threonine kinase 16/Serine/threonine-protein kinase 16 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3938] [GtoPdb: 2213] [UniProtKB: O75716]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
serine/threonine kinase 24/Serine/threonine-protein kinase 24 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5082] [GtoPdb: 2217] [UniProtKB: Q9Y6E0]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
serine/threonine-protein kinase MST4/Serine/threonine-protein kinase 26 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5941] [GtoPdb: 2287] [UniProtKB: Q9P289]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 7.01 pKd 98 nM Kd Science (2017) 358: null-null [PMID:29191878]
serine/threonine kinase 3/Serine/threonine-protein kinase 3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4708] [GtoPdb: 2219] [UniProtKB: Q13188]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Serine/threonine kinase 38 like/Serine/threonine-protein kinase 38-like in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4851] [GtoPdb: 1518] [UniProtKB: Q9Y2H1]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
serine/threonine kinase 4/Serine/threonine-protein kinase 4 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4598] [GtoPdb: 2225] [UniProtKB: Q13043]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
A-Raf proto-oncogene, serine/threonine kinase/Serine/threonine-protein kinase A-Raf in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1169596] [GtoPdb: 1933] [UniProtKB: P10398]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
ATR checkpoint kinase/Serine/threonine-protein kinase ATR in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5024] [GtoPdb: 1935] [UniProtKB: Q13535]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
B-Raf proto-oncogene, serine/threonine kinase/Serine/threonine-protein kinase B-raf in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5145] [GtoPdb: 1943] [UniProtKB: P15056]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
checkpoint kinase 1/Serine/threonine-protein kinase Chk1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4630] [GtoPdb: 1987] [UniProtKB: O14757]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein kinase D2/Serine/threonine-protein kinase D2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4900] [GtoPdb: 2173] [UniProtKB: Q9BZL6]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein kinase D3/Serine/threonine-protein kinase D3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2595] [GtoPdb: 2174] [UniProtKB: O94806]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
endoplasmic reticulum to nucleus signaling 1/Serine/threonine-protein kinase/endoribonuclease IRE1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1163101] [GtoPdb: 2020] [UniProtKB: O75460]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
endoplasmic reticulum to nucleus signaling 2/Serine/threonine-protein kinase/endoribonuclease IRE2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105932] [GtoPdb: 2021] [UniProtKB: Q76MJ5]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
ciliogenesis associated kinase 1/Serine/threonine-protein kinase ICK in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1163126] [GtoPdb: 2038] [UniProtKB: Q9UPZ9]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 6.57 pKd 271 nM Kd Science (2017) 358: null-null [PMID:29191878]
large tumor suppressor kinase 1/Serine/threonine-protein kinase LATS1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL6167] [GtoPdb: 1515] [UniProtKB: O95835]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
microtubule affinity regulating kinase 2/Serine/threonine-protein kinase MARK2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3831] [GtoPdb: 2098] [UniProtKB: Q7KZI7]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
CDC42 binding protein kinase alpha/Serine/threonine-protein kinase MRCK alpha in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4516] [GtoPdb: 1507] [UniProtKB: Q5VT25]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
CDC42 binding protein kinase beta/Serine/threonine-protein kinase MRCK beta in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5052] [GtoPdb: 1508] [UniProtKB: Q9Y5S2]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
CDC42 binding protein kinase gamma/Serine/threonine-protein kinase MRCK gamma in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5615] [GtoPdb: 1506] [UniProtKB: Q6DT37]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein kinase N1/Serine/threonine-protein kinase N1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3384] [GtoPdb: 1520] [UniProtKB: Q16512]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein kinase N2/Serine/threonine-protein kinase N2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3032] [GtoPdb: 1521] [UniProtKB: Q16513]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
protein kinase N3/Serine/threonine-protein kinase N3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3627581] [GtoPdb: 1522] [UniProtKB: Q6P5Z2]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
NIMA related kinase 1/Serine/threonine-protein kinase Nek1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5855] [GtoPdb: 2114] [UniProtKB: Q96PY6]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
NIMA related kinase 2/Serine/threonine-protein kinase Nek2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3835] [GtoPdb: 2117] [UniProtKB: P51955]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
NIMA related kinase 3/Serine/threonine-protein kinase Nek3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5679] [GtoPdb: 2118] [UniProtKB: P51956]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
NIMA related kinase 7/Serine/threonine-protein kinase Nek7 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4849] [GtoPdb: 2122] [UniProtKB: Q8TDX7]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
NIMA related kinase 9/Serine/threonine-protein kinase Nek9 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5257] [GtoPdb: 2124] [UniProtKB: Q8TD19]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
nemo like kinase/Serine/threonine-protein kinase NLK in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5364] [GtoPdb: 2125] [UniProtKB: Q9UBE8]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
p21 (RAC1) activated kinase 2/Serine/threonine-protein kinase PAK 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4487] [GtoPdb: 2134] [UniProtKB: Q13177]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
p21 (RAC1) activated kinase 4/Serine/threonine-protein kinase PAK 4 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4482] [GtoPdb: 2136] [UniProtKB: O96013]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
p21 (RAC1) activated kinase 6/Serine/threonine-protein kinase PAK 6 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4311] [GtoPdb: 2137] [UniProtKB: Q9NQU5]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Pim-1 proto-oncogene, serine/threonine kinase/Serine/threonine-protein kinase pim-1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2147] [GtoPdb: 2158] [UniProtKB: P11309]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Pim-2 proto-oncogene, serine/threonine kinase/Serine/threonine-protein kinase pim-2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4523] [GtoPdb: 2159] [UniProtKB: Q9P1W9]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
polo like kinase 4/Serine/threonine-protein kinase PLK4 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3788] [GtoPdb: 2171] [UniProtKB: O00444]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
salt inducible kinase 2/Serine/threonine-protein kinase SIK2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5699] [GtoPdb: 2198] [UniProtKB: Q9H0K1]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
SIK family kinase 3/Serine/threonine-protein kinase SIK3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL6149] [GtoPdb: 2199] [UniProtKB: Q9Y2K2]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
serine/threonine kinase 11/Serine/threonine-protein kinase STK11 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5606] [GtoPdb: 2212] [UniProtKB: Q15831]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 6.3 pKd 497 nM Kd Science (2017) 358: null-null [PMID:29191878]
TAO kinase 1/Serine/threonine-protein kinase TAO1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5261] [GtoPdb: 2233] [UniProtKB: Q7L7X3]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.75 pKd 17866 nM Kd Science (2017) 358: null-null [PMID:29191878]
TAO kinase 2/Serine/threonine-protein kinase TAO2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1075195] [GtoPdb: 2234] [UniProtKB: Q9UL54]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 5.65 pKd 2233 nM Kd Science (2017) 358: null-null [PMID:29191878]
TAO kinase 3/Serine/threonine-protein kinase TAO3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5701] [GtoPdb: 2235] [UniProtKB: Q9H2K8]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 5.61 pKd 2439 nM Kd Science (2017) 358: null-null [PMID:29191878]
TANK binding kinase 1/Serine/threonine-protein kinase TBK1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5408] [GtoPdb: 2237] [UniProtKB: Q9UHD2]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
unc-51 like autophagy activating kinase 1/Serine/threonine-protein kinase ULK1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL6006] [GtoPdb: 2271] [UniProtKB: O75385]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
unc-51 like kinase 3/Serine/threonine-protein kinase ULK3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5047] [GtoPdb: 2273] [UniProtKB: Q6PHR2]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Signal recognition particle receptor subunit alpha in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105934] [UniProtKB: P08240]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
STE20 like kinase/STE20-like serine/threonine-protein kinase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4202] [GtoPdb: 2200] [UniProtKB: Q9H2G2]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
STE20 related adaptor alpha/STE20-related kinase adapter protein alpha in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1795198] [GtoPdb: 2227] [UniProtKB: Q7RTN6]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Structural maintenance of chromosomes protein 1A in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105747] [UniProtKB: Q14683]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Structural maintenance of chromosomes protein 2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105890] [UniProtKB: O95347]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105973] [UniProtKB: Q9P2R7]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
transforming growth factor beta receptor 1/TGF-beta receptor type-1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4439] [GtoPdb: 1788] [UniProtKB: P36897]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
transforming growth factor beta receptor 2/TGF-beta receptor type-2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4267] [GtoPdb: 1795] [UniProtKB: P37173]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Thyroid hormone receptor-associated protein 3 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105820] [UniProtKB: Q9Y2W1]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
TRAF2 and NCK interacting kinase/TRAF2 and NCK-interacting protein kinase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4527] [GtoPdb: 2244] [UniProtKB: Q9UKE5]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
ABL proto-oncogene 1, non-receptor tyrosine kinase/Tyrosine-protein kinase ABL1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1862] [GtoPdb: 1923] [UniProtKB: P00519]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
ABL proto-oncogene 2, non-receptor tyrosine kinase/Tyrosine-protein kinase ABL2 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4014] [GtoPdb: 1924] [UniProtKB: P42684]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Bruton tyrosine kinase/Tyrosine-protein kinase BTK in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5251] [GtoPdb: 1948] [UniProtKB: Q06187]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
C-terminal Src kinase/Tyrosine-protein kinase CSK in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2634] [GtoPdb: 1994] [UniProtKB: P41240]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
FER tyrosine kinase/Tyrosine-protein kinase Fer in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3982] [GtoPdb: 2022] [UniProtKB: P16591]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
FES proto-oncogene, tyrosine kinase/Tyrosine-protein kinase Fes/Fps in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5455] [GtoPdb: 2023] [UniProtKB: P07332]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
fyn related Src family tyrosine kinase/Tyrosine-protein kinase FRK in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4223] [GtoPdb: 2025] [UniProtKB: P42685]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
FYN proto-oncogene, Src family tyrosine kinase/Tyrosine-protein kinase Fyn in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL1841] [GtoPdb: 2026] [UniProtKB: P06241]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
HCK proto-oncogene, Src family tyrosine kinase/Tyrosine-protein kinase HCK in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3234] [GtoPdb: 2032] [UniProtKB: P08631]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Janus kinase 1/Tyrosine-protein kinase JAK1 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2835] [GtoPdb: 2047] [UniProtKB: P23458]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
LCK proto-oncogene, Src family tyrosine kinase/Tyrosine-protein kinase Lck in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL258] [GtoPdb: 2053] [UniProtKB: P06239]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
LYN proto-oncogene, Src family tyrosine kinase/Tyrosine-protein kinase Lyn in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3905] [GtoPdb: 2060] [UniProtKB: P07948]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
MER proto-oncogene, tyrosine kinase/Tyrosine-protein kinase Mer in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5331] [GtoPdb: 1837] [UniProtKB: Q12866]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
spleen associated tyrosine kinase/Tyrosine-protein kinase SYK in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2599] [GtoPdb: 2230] [UniProtKB: P43405]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
tec protein tyrosine kinase/Tyrosine-protein kinase Tec in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4246] [GtoPdb: 2238] [UniProtKB: P42680]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
YES proto-oncogene 1, Src family tyrosine kinase/Tyrosine-protein kinase Yes in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL2073] [GtoPdb: 2284] [UniProtKB: P07947]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Tyrosine--tRNA ligase, cytoplasmic in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL3179] [UniProtKB: P54577]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
U5 small nuclear ribonucleoprotein 200 kDa helicase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105972] [UniProtKB: O75643]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
UMP-CMP kinase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5681] [UniProtKB: P30085]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
aarF domain containing kinase 5/Uncharacterized aarF domain-containing protein kinase 5 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105886] [GtoPdb: 1929] [UniProtKB: Q3MIX3]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Uncharacterized protein FLJ45252 in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105933] [UniProtKB: Q6ZSR9]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
Very long-chain specific acyl-CoA dehydrogenase, mitochondrial in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL4105892] [UniProtKB: P49748]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]
WEE1 G2 checkpoint kinase/Wee1-like protein kinase in Human (target type: SINGLE PROTEIN) [ChEMBL: CHEMBL5491] [GtoPdb: 2278] [UniProtKB: P30291]
ChEMBL Kinobeads (epsilon), multiple immobilized ATP-competitive broad spectrum kinase inhibitors, used to assess residual binding of ~300 proteins simultaneously from cell lysate in the presence of a compound. Quantitative readout performed by mass spectrometry. B 4.52 pKd >30000 nM Kd Science (2017) 358: null-null [PMID:29191878]

ChEMBL data shown on this page come from version 36:

Zdrazil B, Felix E, Hunter F, Manners EJ, Blackshaw J, Corbett S, de Veij M, Ioannidis H, Lopez DM, Mosquera JF, Magarinos MP, Bosc N, Arcila R, Kizilören T, Gaulton A, Bento AP, Adasme MF, Monecke P, Landrum GA, Leach AR. (2024). The ChEMBL Database in 2023: a drug discovery platform spanning multiple bioactivity data types and time periods. Nucleic Acids Res., 52(D1). DOI: 10.1093/nar/gkad1004. [EPMCID:10767899] [PMID:37933841]
Davies M, Nowotka M, Papadatos G, Dedman N, Gaulton A, Atkinson F, Bellis L, Overington JP. (2015) 'ChEMBL web services: streamlining access to drug discovery data and utilities.' Nucleic Acids Res., 43(W1). DOI: 10.1093/nar/gkv352. [EPMCID:25883136]