GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

CXCL12γ   Click here for help

GtoPdb Ligand ID: 8530

Immunopharmacology Ligand
Comment: CXCL12-γ is produced by alternative splicing of the CXCL12 gene and it is almost twice as large as CXCL12α and CXCL12β. It is a low affinity CXCR4 agonist and has limited signal transduction capacity. Expression of this γ isoform is mainly restricted to regions of adult brain and heart in humans and rats. In the mouse heart, CXCL12-γ localises to the nucleus via canonical nuclear localization signals and to the nucleolus via a specific nucleolar localization signal (NoLS) in its unique C-terminal region [3]. This suggests an intracellular signalling function for this isoform, which would make it unique amongst all of the known chemokines.
Species: Human
Peptide Sequence Click here for help
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKGRREEKVGKKEK
IGKKKRQKKRKAAQKRKN
Lys-Pro-Val-Ser-Leu-Ser-Tyr-Arg-Cys-Pro-Cys-Arg-Phe-Phe-Glu-Ser-His-Val-Ala-Arg-Ala-Asn-Val-Lys-His-Leu-Lys-Ile-Leu-Asn-Thr-Pro-Asn-Cys-Ala-Leu-Gln-Ile-Val-Ala-Arg-Leu-Lys-Asn-Asn-Asn-Arg-Gln-Val-Cys-Ile-Asp-Pro-Lys-Leu-Lys-Trp-Ile-Gln-Glu-Tyr-Leu-Glu-Lys-Ala-Leu-Asn-Lys-Gly-Arg-Arg-Glu-Glu-Lys-Val-Gly-Lys-Lys-Glu-Lys-Ile-Gly-Lys-Lys-Lys-Arg-Gln-Lys-Lys-Arg-Lys-Ala-Ala-Gln-Lys-Arg-Lys-Asn