CXCL12γ

Ligand id: 8530

Name: CXCL12γ

Species: Human

Peptide Sequence
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKGRREEKVGKKEK
IGKKKRQKKRKAAQKRKN
Lys-Pro-Val-Ser-Leu-Ser-Tyr-Arg-Cys-Pro-Cys-Arg-Phe-Phe-Glu-Ser-His-Val-Ala-Arg-Ala-Asn-Val-Lys-His-Leu-Lys-Ile-Leu-Asn-Thr-Pro-Asn-Cys-Ala-Leu-Gln-Ile-Val-Ala-Arg-Leu-Lys-Asn-Asn-Asn-Arg-Gln-Val-Cys-Ile-Asp-Pro-Lys-Leu-Lys-Trp-Ile-Gln-Glu-Tyr-Leu-Glu-Lys-Ala-Leu-Asn-Lys-Gly-Arg-Arg-Glu-Glu-Lys-Val-Gly-Lys-Lys-Glu-Lys-Ile-Gly-Lys-Lys-Lys-Arg-Gln-Lys-Lys-Arg-Lys-Ala-Ala-Gln-Lys-Arg-Lys-Asn