GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

IL-1 receptor antagonist   Click here for help

GtoPdb Ligand ID: 5878

Synonyms: IL-1ra | interleukin-1 receptor antagonist protein | IRAP
Immunopharmacology Ligand
Comment: A recombinant, non-glycosylated version of this protein is marketed as rheumatoid arthritis drug anakinra.
Species: Human
Peptide Sequence Click here for help
RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQL
EAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Arg-Pro-Ser-Gly-Arg-Lys-Ser-Ser-Lys-Met-Gln-Ala-Phe-Arg-Ile-Trp-Asp-Val-Asn-Gln-Lys-Thr-Phe-Tyr-Leu-Arg-Asn-Asn-Gln-Leu-Val-Ala-Gly-Tyr-Leu-Gln-Gly-Pro-Asn-Val-Asn-Leu-Glu-Glu-Lys-Ile-Asp-Val-Val-Pro-Ile-Glu-Pro-His-Ala-Leu-Phe-Leu-Gly-Ile-His-Gly-Gly-Lys-Met-Cys-Leu-Ser-Cys-Val-Lys-Ser-Gly-Asp-Glu-Thr-Arg-Leu-Gln-Leu-Glu-Ala-Val-Asn-Ile-Thr-Asp-Leu-Ser-Glu-Asn-Arg-Lys-Gln-Asp-Lys-Arg-Phe-Ala-Phe-Ile-Arg-Ser-Asp-Ser-Gly-Pro-Thr-Thr-Ser-Phe-Glu-Ser-Ala-Ala-Cys-Pro-Gly-Trp-Phe-Leu-Cys-Thr-Ala-Met-Glu-Ala-Asp-Gln-Pro-Val-Ser-Leu-Thr-Asn-Met-Pro-Asp-Glu-Gly-Val-Met-Val-Thr-Lys-Phe-Tyr-Phe-Gln-Glu-Asp-Glu
Post-translational Modification
N-linked glycosylation of asparagine residue at position 84; disulphide bond between cysteine residues at positions 66 and 116.