GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

CD40 ligand   Click here for help

GtoPdb Ligand ID: 5077

Synonyms: CD40 ligand, membrane form
Immunopharmacology Ligand
Comment: The CD40 ligand precursor is also cleaved into a soluble form of the ligand
Species: Human
Peptide Sequence Click here for help
MIETYNQTSPRSAATGLPISMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLHEDFVFMKTIQRCNTGERSLS
LLNCEEIKSQFEGFVKDIMLNKEETKKENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQ
LTVKRQGLYYIYAQVTFCSNREASSQAPFIASLCLKSPGRFERILLRAANTHSSAKPCGQQSIHLGGVFELQPGASVFVN
VTDPSQVSHGTGFTSFGLLKL
Selected 3D Structures
PDB Id: 1aly
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
N-linked glycosylation of asparagine at position 240; predicted phosphothreonine at position 4; predicted disulphide bond formation between cysteine residues at positions 178 and 218