GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

IL-11   Click here for help

GtoPdb Ligand ID: 4976

Synonyms: interleukin-11
Immunopharmacology Ligand
Comment: IL-11 is a member of the IL-6-type cytokine family. The recombinant form of human IL-11 is an approved drug with INN oprelvekin.
Species: Human
Peptide Sequence Click here for help
PGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADL
LSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGL
HLTLDWAVRGLLLLKTRL