GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

FGF-21   Click here for help

GtoPdb Ligand ID: 11721

Synonyms: fibroblast growth factor 21
Comment: FGF21 is a mitogen that is involved in the migration and differentiation of cells that are of mesodermal or neuroectodermal origin, and in metabolic regulation [2]. Klotho beta (KLB) appears to be required for FGF21's metabolic activity [3]. The peptide sequence provided here includes the signal peptide (MDSDETGFEHSGLWVSVLAGLLLGACQA).
Species: Human
Peptide Sequence Click here for help
HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPMDSDETGFEHSGLWVSVLAG
LLLGACQAGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRG
PARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS