apelin-36

Ligand id: 606

Name: apelin-36

Species: Human

Peptide Sequence
LVQPRGPRSGPGPWQGGRRKFRRQRPRLSHKGPMPF
Leu-Val-Gln-Pro-Arg-Gly-Pro-Arg-Ser-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe