apelin-36   

GtoPdb Ligand ID: 606

Comment: The PubChem link above links to a chemical structure for apelin-36.
Species: Human
Peptide Sequence
LVQPRGPRSGPGPWQGGRRKFRRQRPRLSHKGPMPF
Leu-Val-Gln-Pro-Arg-Gly-Pro-Arg-Ser-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe