IL-3   Click here for help

GtoPdb Ligand ID: 4994

Synonyms: interleukin-3 (IL-3) | multilineage-colony-stimulating factor (mCSF)
Immunopharmacology Ligand
Compound class: Endogenous peptide in human, mouse or rat
Comment: IL-3 and GM-CSF share certain functional similarities.
Species: Human
Peptide Sequence Click here for help
APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKN
LLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Post-translational Modification
Predicted N-linked glycosylation of aspragine residues at positions 15 and 70; disulphide bond fromation between cysteine residues at positions 14 and 84