GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

IL-24   Click here for help

GtoPdb Ligand ID: 4990

Synonyms: interleukin-24 | MDA-7 | melanoma differentiation-associated gene 7 protein
Immunopharmacology Ligand
Comment: IL-24 is an IL-10 related type II cytokine.
Species: Human
Peptide Sequence Click here for help
QEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEV
RTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL
Post-translational Modification
Predicted N-linked glycosylation of asparagine residues at positions 34, 48 and 75