GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

IL-18   Click here for help

GtoPdb Ligand ID: 4983

Synonyms: ibocatdekin | interferon-γ-inducing factor | interleukin-1 gamma (IL-1 gamma) | interleukin-18
Immunopharmacology Ligand
Comment: IL-18 is an IL-1 family cytokine. It acts as a pleiotropic pro-inflammatory cytokine, and it is important for host innate and adaptive immune defense against pathogenic infections. Dysregulated IL-18 activity is associated with inflammatory and autoimmune diseases (e.g. rheumatoid arthritis, Crohn's disease, MS and lupus), allergies, and neurological disorders. IL-18 and its signalling partners are protein targets for anti-inflammatory drug development.
Species: Human
Peptide Sequence Click here for help
YFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKI
ISFKEMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDELGDRSIMFTVQNED
Selected 3D Structures
PDB Id: 1J0S
Image of ligand 3D structure from RCSB PDB