GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
Synonyms: CTLA-8 | interleukin-17 alpha
Compound class:
Endogenous peptide in human, mouse or rat
Comment: Forms homodimeric ligand IL-17A, or heterodimeric IL-17A/IL-17F.
Species: Human
|
Is a component of |
IL-17A/IL-17F |
Peptide Sequence ![]() |
|
GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINAD GNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA |
Selected 3D Structures | ||
|
Post-translational Modification | |
Predicted N-linked glycosylation of aspragine residue at position 45; predicted disulphide bond formation between cysteine residues at positions 71 and 121, and 76 and 123 |