GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

IL-10   Click here for help

GtoPdb Ligand ID: 4975

Synonyms: interleukin-10
Immunopharmacology Ligand
Comment: Biologically active IL-10 is a homodimer. It is an anti-inflammatory cytokine.
Species: Human
Click here for help
Peptide Sequence Click here for help
SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQA
ENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Selected 3D Structures
PDB Id: 2H24
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Predicted N-linked glycosylation of asparagine at position 116; disulphide bonds between cysteine residues at positions 12 and 108, and 62 and 114