GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
Synonyms: IFN-α1 | IFN-α13 | IFN-alpha 1/13 | interferon alpha-1/13 | interferon alpha-D
Compound class:
Endogenous peptide in human, mouse or rat
Comment: Interferon-αs are type I IFNs (includes IFNαs, IFN-β, IFN-ε, IFN-κ and IFN-ω). In humans, there are 13 different IFN-α genes , but only 12 functional human IFN-α proteins, since IFN-α1 and IFN-α13 have identical protein sequences despite being encoded by separate genes.
Species: Human
|
Peptide Sequence ![]() |
|
CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDED LLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQE RLRRKE |
Post-translational Modification | |
Phosphylated threonine residue at position 128; predicted disulphide bonds between cysteine residues at positions 1 and 99 and 29 and 139 |