CXCL5

Ligand id: 4464

Name: CXCL5

Species: Rat

Peptide Sequence
APFSAMVATELRCVCLTLAPRINPKMIANLEVIPAGPHCPKVEVIAKLKNQKDNVCLDPQAPLIKKVIQKILGSENKKTK
RNALALVRSASTQ
Ala-Pro-Phe-Ser-Ala-Met-Val-Ala-Thr-Glu-Leu-Arg-Cys-Val-Cys-Leu-Thr-Leu-Ala-Pro-Arg-Ile-Asn-Pro-Lys-Met-Ile-Ala-Asn-Leu-Glu-Val-Ile-Pro-Ala-Gly-Pro-His-Cys-Pro-Lys-Val-Glu-Val-Ile-Ala-Lys-Leu-Lys-Asn-Gln-Lys-Asp-Asn-Val-Cys-Leu-Asp-Pro-Gln-Ala-Pro-Leu-Ile-Lys-Lys-Val-Ile-Gln-Lys-Ile-Leu-Gly-Ser-Glu-Asn-Lys-Lys-Thr-Lys-Arg-Asn-Ala-Leu-Ala-Leu-Val-Arg-Ser-Ala-Ser-Thr-Gln