LH β subunit   Click here for help

GtoPdb Ligand ID: 3732

Synonyms: LHβ | luteinising hormone subunit beta | luteinizing hormone subunit beta | lutropin subunit beta
Species: Human
Is a component of
Peptide Sequence Click here for help
SREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVV
SFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFL
Ser-Arg-Glu-Pro-Leu-Arg-Pro-Trp-Cys-His-Pro-Ile-Asn-Ala-Ile-Leu-Ala-Val-Glu-Lys-Glu-Gly-Cys-Pro-Val-Cys-Ile-Thr-Val-Asn-Thr-Thr-Ile-Cys-Ala-Gly-Tyr-Cys-Pro-Thr-Met-Met-Arg-Val-Leu-Gln-Ala-Val-Leu-Pro-Pro-Leu-Pro-Gln-Val-Val-Cys-Thr-Tyr-Arg-Asp-Val-Arg-Phe-Glu-Ser-Ile-Arg-Leu-Pro-Gly-Cys-Pro-Arg-Gly-Val-Asp-Pro-Val-Val-Ser-Phe-Pro-Val-Ala-Leu-Ser-Cys-Arg-Cys-Gly-Pro-Cys-Arg-Arg-Ser-Thr-Ser-Asp-Cys-Gly-Gly-Pro-Lys-Asp-His-Pro-Leu-Thr-Cys-Asp-His-Pro-Gln-Leu-Ser-Gly-Leu-Leu-Phe-Leu
Post-translational Modification
N-linked glycosylation at residue 50; disulphide bonds between residues 29 and 77, 43 and 92, 46 and 130, 54 and 108, 58 and 110 and 113 and 120. The production of biologically active LH requires appropriately folded and glycosylated LHβ and common α subunits that assemble to form the active LH heterodimer [1].