GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

PHV   Click here for help

GtoPdb Ligand ID: 2275

Synonyms: intestinal peptide PHV-42 | peptide histidine-valine
Comment: The rat sequence has been used in pharmacological studies. The human sequence differs at residues 17, 27 and 31. The mouse sequence has C-terminal isoleucine.
Species: Rat
Click here for help
Peptide Sequence Click here for help
HADGVFTSDYSRLLGQISAKKYLESLIGKRISSSISEDPVPV
His-Ala-Asp-Gly-Val-Phe-Thr-Ser-Asp-Tyr-Ser-Arg-Leu-Leu-Gly-Gln-Ile-Ser-Ala-Lys-Lys-Tyr-Leu-Glu-Ser-Leu-Ile-Gly-Lys-Arg-Ile-Ser-Ser-Ser-Ile-Ser-Glu-Asp-Pro-Val-Pro-Val-NH2
Post-translational Modification
C-terminal residue is valine amide