GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

peptide YY   Click here for help

GtoPdb Ligand ID: 1514

Abbreviated name: PYY
Synonyms: peptide tyrosine tyrosine
Comment: Peptide YY is a neuropeptide Y2 receptor agonist. It has been investigated as a potential appetite suppressant [2,6,8-9].
Species: Human
Click here for help
IUPHAR Pharmacology Education Project (PEP) logo

View more information in the IUPHAR Pharmacology Education Project: peptide yy

Peptide Sequence Click here for help
YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY
Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
Post-translational Modification
The C-terminal tyrosine is amidated.