peptide 5A   Click here for help

GtoPdb Ligand ID: 10588

Comment: Peptide 5A is an apoA-I-mimetic that has been reported to reduce atherosclerosis [1], acute vascular inflammation, and oxidative stress in experimental animal models. It has subsequently been identified as an antagonistic ligand for the scavenger receptor CD36 and experimental evidence indicates that CD36 is its main pharmacological target [2].
Peptide Sequence Click here for help
DWLKAFYDKVAEKLKEAFPDWAKAAYDKAAEKAKEAA
Asp-Trp-Leu-Lys-Ala-Phe-Tyr-Asp-Lys-Val-Ala-Glu-Lys-Leu-Lys-Glu-Ala-Phe-Pro-Asp-Trp-Ala-Lys-Ala-Ala-Tyr-Asp-Lys-Ala-Ala-Glu-Lys-Ala-Lys-Glu-Ala-Ala