GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

IL-12B   Click here for help

GtoPdb Ligand ID: 5002

Synonyms: IL-12 p40 | IL-12B monomer | interleukin-12β | interleukin-12B | natural killer cell stimulatory factor 2
Immunopharmacology Ligand
Comment: This is the common p40 subunit of pro-inflammatory cytokines IL-12 and IL-23.
Species: Human
Is a component of
Peptide Sequence Click here for help
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLL
LLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRG
DNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTW
STPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Post-translational Modification
N-linked glycosylation of asparagine residue at position 100; C-linked glycosylation of tryptophan at position 297, and disulphide bond formation between cysteine residues at positions 28 and 68, 109 and 120, 148 and 171, and 278 and 305. Predicted N-linked glycosylation of aspragibe at position 113. In the IL12A/Il12B heteromer there is an interchain disulphide bond between cysteine residues at positions 177 of the beta chain and 74 in the alpha chain.