CCK-33

Ligand id: 860

Name: CCK-33

Species: Human

IUPHAR Pharmacology Education Project (PEP) logo

View more information in the IUPHAR Pharmacology Education Project: cck-33

Structure and Physico-chemical Properties

2D Structure
Click here for structure editor
Peptide Sequence
KAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDF
Lys-Ala-Pro-Ser-Gly-Arg-Met-Ser-Ile-Val-Lys-Asn-Leu-Gln-Asn-Leu-Asp-Pro-Ser-His-Arg-Ile-Ser-Asp-Arg-Asp-Tys-Met-Gly-Trp-Met-Asp-Phe-NH2
Post-translational Modification
The C-terminal phenylalanine is amidated and the tyrosine residue at position 27 is sulfated, as indicated by Tys which represents Tyr(SO3H).
Download 2D Structure
Canonical SMILES Download
Isomeric SMILES Download
InChI standard identifier Download
InChI standard key Download

Molecular structure representations generated using Open Babel