Elabela/Toddler-32

Ligand id: 8524

Name: Elabela/Toddler-32

Abbreviated name: ELA-32

Species: Human

Structure and Physico-chemical Properties

2D Structure
Click here for structure editor
Peptide Sequence
QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP
Gln-Arg-Pro-Val-Asn-Leu-Thr-Met-Arg-Arg-Lys-Leu-Arg-Lys-His-Asn-Cys-Leu-Gln-Arg-Arg-Cys-Met-Pro-Leu-His-Ser-Arg-Val-Pro-Phe-Pro
Download 2D Structure
Canonical SMILES Download
Isomeric SMILES Download
InChI standard identifier Download
InChI standard key Download

Molecular structure representations generated using Open Babel