GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

CCL11   Click here for help

GtoPdb Ligand ID: 787

Synonyms: murine eotaxin
Immunopharmacology Ligand
Comment: This is the mouse homolog of human CCL11.
Species: Mouse
Click here for help
Peptide Sequence Click here for help
HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP
His-Pro-Gly-Ser-Ile-Pro-Thr-Ser-Cys-Cys-Phe-Ile-Met-Thr-Ser-Lys-Lys-Ile-Pro-Asn-Thr-Leu-Leu-Lys-Ser-Tyr-Lys-Arg-Ile-Thr-Asn-Asn-Arg-Cys-Thr-Leu-Lys-Ala-Ile-Val-Phe-Lys-Thr-Arg-Leu-Gly-Lys-Glu-Ile-Cys-Ala-Asp-Pro-Lys-Lys-Lys-Trp-Val-Gln-Asp-Ala-Thr-Lys-His-Leu-Asp-Gln-Lys-Leu-Gln-Thr-Pro-Lys-Pro
Post-translational Modification
O-linked glycoslylation of residue 71 and disulphide bond formation between cysteine residues at postions 9 and 34, and 10 and 50