GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

IL-17C   Click here for help

GtoPdb Ligand ID: 5875

Synonyms: cytokine CX2 | interleukin-17C
Immunopharmacology Ligand
Comment: IL-17C is an IL-17 homolog, secreted by epithelial cells in response to bacterial challenge and inflammatory stimuli and that acts in an autocrine manner to control the innate epithelial immune responses necessary for regulating intestinal inflammation and barrier function [1-2].
Species: Human
Peptide Sequence Click here for help
HHDPSLRGHPHSHGTPHCYSAEELPLGQAPPHLLARGAKWGQALPVALVSSLEAASHRGRHERPSATTQCPVLRPEEVLE
ADTHQRSISPWRYRVDTDEDRYPQKLAFAECLCRGCIDARTGRETAALNSVRLLQSLLVLRRRPCSRDGSGLPTPGAFAF
HTEFIHVPVGCTCVLPRSV
His-His-Asp-Pro-Ser-Leu-Arg-Gly-His-Pro-His-Ser-His-Gly-Thr-Pro-His-Cys-Tyr-Ser-Ala-Glu-Glu-Leu-Pro-Leu-Gly-Gln-Ala-Pro-Pro-His-Leu-Leu-Ala-Arg-Gly-Ala-Lys-Trp-Gly-Gln-Ala-Leu-Pro-Val-Ala-Leu-Val-Ser-Ser-Leu-Glu-Ala-Ala-Ser-His-Arg-Gly-Arg-His-Glu-Arg-Pro-Ser-Ala-Thr-Thr-Gln-Cys-Pro-Val-Leu-Arg-Pro-Glu-Glu-Val-Leu-Glu-Ala-Asp-Thr-His-Gln-Arg-Ser-Ile-Ser-Pro-Trp-Arg-Tyr-Arg-Val-Asp-Thr-Asp-Glu-Asp-Arg-Tyr-Pro-Gln-Lys-Leu-Ala-Phe-Ala-Glu-Cys-Leu-Cys-Arg-Gly-Cys-Ile-Asp-Ala-Arg-Thr-Gly-Arg-Glu-Thr-Ala-Ala-Leu-Asn-Ser-Val-Arg-Leu-Leu-Gln-Ser-Leu-Leu-Val-Leu-Arg-Arg-Arg-Pro-Cys-Ser-Arg-Asp-Gly-Ser-Gly-Leu-Pro-Thr-Pro-Gly-Ala-Phe-Ala-Phe-His-Thr-Glu-Phe-Ile-His-Val-Pro-Val-Gly-Cys-Thr-Cys-Val-Leu-Pro-Arg-Ser-Val
Post-translational Modification
Predicted disulphide bond formation between cysteine residues at positions 111 and 171, and 106 and 173.