Is a component of

inhibin B

activin AB

activin B

Peptide Sequence

GLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCC IPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA

Post-translational Modification

Forms a heterodimer with either inhibin alpha chain (forming inhibin B) or inhibin beta-A (forming activin AB). The third form of the active peptide is a homodimer of two beta-B chains forming activin-B. Predicted interchain disulphide bond formation between cysteine residues at position 79. Predicted disulphide bond formation between cysteine residues at positions 4 and 12; 11 and 80, 40 and 112, and 44 and 114