GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

IL-5   Click here for help

GtoPdb Ligand ID: 4997

Immunopharmacology Ligand
Comment: IL-5 is one of the hematopoietic family cytokines. Unlike other family members IL-3 and GM-CSF, IL-5 is a homodimer, consisting of two identical amino acid chains linked by two disulphide bonds
Species: Human
Peptide Sequence Click here for help
IPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNHQLCTEEIFQGIGTLESQTVQGGTVERLFKNLSLIKKYID
GQKKKCGEERRRVNQFLDYLQEFLGVMNTEWIIES
Selected 3D Structures
PDB Id: 1HUL
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Il-5 is a homodimer of two amino acid chains. Predicted O linked glycosylation of threonine residue at position 3; predicted N linked glycosylation of asparagine residue at position 28, and two interchain disulphide bonds between residues 44 and 86 of each chain