GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
Synonyms: IFN-lambda-1 | interferon lambda-1 | interferon-λ1 | interleukin-29
Compound class:
Endogenous peptide in human, mouse or rat
Comment: The IFN-λs are type III IFNs.
Species: Human
|
Peptide Sequence ![]() |
|
GPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTL KVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTR DLKYVADGNLCLRTSTHPEST |
Selected 3D Structures | ||
|
Post-translational Modification | |
Predicted N-linked glycosylation of aspragine residue at position 46; disulphide bond formation between cysteine residues at positions 49 and 145 |