IFN-λ1   Click here for help

GtoPdb Ligand ID: 4993

Synonyms: IFN-lambda-1 | interferon lambda-1 | interferon-λ1 | interleukin-29
Immunopharmacology Ligand
Compound class: Endogenous peptide in human, mouse or rat
Comment: The IFN-λs are type III IFNs.
Species: Human
Peptide Sequence Click here for help
GPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTL
KVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTR
DLKYVADGNLCLRTSTHPEST
Selected 3D Structures
PDB Id: 3OG4
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Predicted N-linked glycosylation of aspragine residue at position 46; disulphide bond formation between cysteine residues at positions 49 and 145