Synonyms: cytokine Zcyto10 | interleukin-20
Compound class:
Endogenous peptide in human, mouse or rat
Comment: IL-20 is an IL-10 related type II cytokine. The IL-20 pathway is a pharmacological target with potential therapeutic benefit for patients wth rheumatoid arthritis [1].
Species: Human
|
Peptide Sequence ![]() |
|
LKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHY TLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE |
Post-translational Modification | |
Predicted disulphide bond formation between cysteine residues at positions 9 and 102, 56 and 108, and 57 and 110 |