Synonyms: interleukin-19 | melanoma differentiation-associated protein-like protein
Compound class:
Endogenous peptide in human, mouse or rat
Comment: IL-19 is an IL-10 related type II cytokine.
Species: Human
|
Peptide Sequence ![]() |
|
LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKI SSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA |
Selected 3D Structures | ||
|
Post-translational Modification | |
Predicted N-linked glycosylation of asparagine residues at positions 32 and 111; disulphide bomd formation between cysteine residues at positions 4 and 97, 51 and 103, and 52 and 105 |