Synonyms: interleukin-15
Compound class:
Endogenous peptide in human, mouse or rat
Comment: IL-15 and IL-2 are cytokines that share common biological effects, but also exhibit distinct, and sometimes competing, functions [7].
Nektar Therapeutics is developing a long-acting polymer-engineered (e.g. PEGylated) IL-15 conjugate, code named NKTR-255 (structure not disclosed), as a potential immuno-oncology agent- see their patent US20170035898 [4]. The conjugate has been optimised for binding to the IL-15Rα subunit and improved plasma and tumour exposure compared to native IL-15. This agent is in preclinical evaluation (August 2017). Calypso Biotech have an anti-IL-15 monoclonal antibody named CALY-002 in their development pipeline. CALY-002 has potential for the treatment of refractory celiac disease and other inflammatory conditions at mucosal interfaces within the gastro-intestinal tract (e.g. eosinophilic esophagitis) [6]. The EMA granted CALY-002 orphan drug designation for the treatment of eosinophilic esophagitis in 2016 [2].
Species: Human
Ligand Activity Visualisation ChartsThese are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts. ✖ |
Peptide Sequence | |
NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNV TESGCKECEELEEKNIKEFLQSFVHIVQMFINTS |
Selected 3D Structures | ||
|
Post-translational Modification | |
Predicted N-linked glycosylation of asparagine residue at position 79; predicted disulphide bonds between cysteine residues at positions 35 and 85, and 42 and 88 |