Synonyms: astrocyte-derived trophic factor (ATF)
Compound class:
Endogenous peptide in human, mouse or rat
Comment: Biologically active GDNF is a disulphide-linked homodimer
Species: Human
|
Peptide Sequence | |
SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYD KILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI |
Selected 3D Structures | ||
|
Post-translational Modification | |
Biologically active peptide is a homodimer. Disulphide bonds between cysteine residues at positions 41 and 102, 68 and 131, and 72 and 133. Interchain diuslphide bond between cysteine residues at position 1 of each chain. Predicted N-linked glycosylation of asparagine residues at positions 49 and 85 |