GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
Synonyms: Granocyte®
G-CSF is an approved drug
Compound class:
Endogenous peptide in human, mouse or rat
Comment: Lenograstim is a recombinant form of glycosylated granulocyte colony-stimulating factor, with exactly the same sequence and function as the endogenous peptide.
Species: Human
|
Peptide Sequence ![]() |
|
ATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLS QLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASH LQSFLEVSYRVLRHLAQP |
Selected 3D Structures | ||
|
Post-translational Modification | |
Predicted O-linked glycosylation of threonine at position 137; disulphide bond formation between cysteine residues at positions 40 and 46, and 68 and 78 |