GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

ephrin-A5   Click here for help

GtoPdb Ligand ID: 4912

Abbreviated name: EFNA5
Synonyms: AL-1 | EPH-related receptor tyrosine kinase ligand 7 | LERK-7
Comment: From the ephrin A family of glycosylphosphatidylinositol-linked proteins
Species: Human
Peptide Sequence Click here for help
QDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRW
ECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDK
VENSLEPADDTVHESAEPSRGEN
Selected 3D Structures
PDB Id: 1shw
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Predicted disulphide bond formation between cysteine residues at positions 42 and 82, and 70 and 131. Predicted amidation of C-terminal asparagine residue; predicted N-linked glycosylation of asparagine residue at position 17