ephrin-A2   Click here for help

GtoPdb Ligand ID: 4909

Abbreviated name: EFNA2
Synonyms: EPH-related receptor tyrosine kinase ligand 6 | HEK7 ligand | HEK7-L
Compound class: Endogenous peptide in human, mouse or rat
Comment: From the ephrin A family of glycosylphosphatidylinositol-linked proteins
Species: Human
Peptide Sequence Click here for help
RAEDAARANSDRYAVYWNRSNPRFHAGAGDDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMEHYVLYMVNGEGHASCDH
RQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPI
FTSN
Selected 3D Structures
PDB Id: 2WO3
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 49 and 90, and 78 and 139. Predicted amidation of C-terminal asparagine residue; predicted N-linked glycosylation of asparagine residues at positions 18, 150 and 164