choriomammotropin   Click here for help

GtoPdb Ligand ID: 4893

Compound class: Endogenous peptide in human, mouse or rat
Comment: Choriomammotropin occurs in monomeric and dimeric forms
Species: Human
Peptide Sequence Click here for help
VQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISL
LLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNY
GLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
Selected 3D Structures
PDB Id: 1Z7C
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 53 and 165. In the monomeric form of choriomammotropin, there is a disulphide bond between cysteine residues at positions 182 and 189, while in the dimeric form there are two interchain disulphide bonds between cysteine residues at positions 208 and 215 of each chain