GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

BMP-9   Click here for help

GtoPdb Ligand ID: 4889

Synonyms: bone morphogenetic protein 9 | GDF-2
Comment: The active peptide is a disulphide bond-linked homodimer
Species: Human
Peptide Sequence Click here for help
SAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLS
PISVLYKDDMGVPTLKYHYEGMSVAECGCR
Selected 3D Structures
PDB Id: 1zkz
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
The active peptide is a homodimer linked by a disulphide bond between cysteine residues at position 73 of each chain. Disulphide bond formation between cysteine residues at positions 8 and 74, 37 and 107, and 41 and 109