GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
Synonyms: bone morphogenetic protein 9 | GDF-2
Compound class:
Endogenous peptide in human, mouse or rat
Comment: The active peptide is a disulphide bond-linked homodimer
Species: Human
|
Peptide Sequence ![]() |
|
SAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLS PISVLYKDDMGVPTLKYHYEGMSVAECGCR |
Selected 3D Structures | ||
|
Post-translational Modification | |
The active peptide is a homodimer linked by a disulphide bond between cysteine residues at position 73 of each chain. Disulphide bond formation between cysteine residues at positions 8 and 74, 37 and 107, and 41 and 109 |