BMP-5   Click here for help

GtoPdb Ligand ID: 4884

Compound class: Endogenous peptide in human, mouse or rat
Comment: The active peptide is a disulphide bond-linked homodimer
Species: Human
Peptide Sequence Click here for help
AANKRKNQNRNKSSSHQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNA
TNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH
Post-translational Modification
The active peptide is a homodimer linked by a disulphide bond between cysteine residues at position 102 of each chain. Predicted N-linked glycososylation of asparagine residues at positions 11, 29 and 79. Predicted disulphide bond formation between cysteine residues at positions 37 and 103, 66 and 135, and 70 and 137