GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

BMP-4   Click here for help

GtoPdb Ligand ID: 4883

Synonyms: BMP-2B | bone morphogenetic protein 2B
Comment: The active peptide is a disulphide bond-linked homodimer
Species: Human
Peptide Sequence Click here for help
SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKAC
CVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
Selected 3D Structures
PDB Id: 1reu
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
The active peptide is a homodimer linked by a disulphide bond between cysteine residues at position 80. Predicted N-linked glycosylation of asparagine residues at positions 58 and 73, and predicted disulphide bond formation between cysteine residues at positions 16 and 81, 45 and 113, and 49 and 115