BMP-15

Home
Ligands
BMP-15 (Human)

GtoPdb Ligand ID: 4880

Synonyms: GDF-9B | growth/differentiation factor 9B

Compound class: Endogenous peptide in human, mouse or rat

Comment: The BMP-15 gene is X-linked and expressed in oocytes. BMP-15 protein appears to be involved in early ovarian folliculogenesis [1-3], acting in synergy with growth/differentiation factor-9 [4]. BMP-15 is a selective modulator of FSH action [3]. The active peptide is a disulphide bond-linked homodimer.

Species: Human

Peptide Sequence
QADGISAEVTASSSKHSGPENNQCSLHPFQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQL VDQSVPRPSCVPYKYVPISVLMIEANGSILYKEYEGMIAESCTCR

Post-translational Modification
The active peptide is a homodimer, which in contrast to other bone-morphogentic proteins is not disulphide linked. C-terminal glutamine residue is pyrrolidone carboxylic acid; serine residue at position 6 is phosphoserine; threonine resdiue at position 10 is O-linked glycosylated; asparagine resdiue at position 106 is predicted to be N-linked glycosylated; predicted disulphide bond formation between cysteine residues at positions 24 and 90, 53 and 122, and 57 and 124

Post-translational Modification

The active peptide is a homodimer, which in contrast to other bone-morphogentic proteins is not disulphide linked. C-terminal glutamine residue is pyrrolidone carboxylic acid; serine residue at position 6 is phosphoserine; threonine resdiue at position 10 is O-linked glycosylated; asparagine resdiue at position 106 is predicted to be N-linked glycosylated; predicted disulphide bond formation between cysteine residues at positions 24 and 90, 53 and 122, and 57 and 124