Compound class:
Endogenous peptide in human, mouse or rat
Species: Mouse
|
Is a component of |
protein C |
Peptide Sequence | |
ANSFLEEMRPGSLERECMEEICDFEEAQEIFQNVEDTLAFWIKYFDGDQCSAPPLDHQCDSPCCGHGTCIDGIGSFSCSC DKGWEGKFCQQELRFQDCRVNNGGCLHYCLEESNGRRCACAPGYELADDHMRCKSTVNFPCGKLGRWIEKKRKIL |
Post-translational Modification | |
Mouse protein C consists of a light chain and a heavy chain held together by a disulfide bond between cysteine residues at positions 141 of the light chain and 121 of the heavy chain |