CXCL16

Ligand id: 4467

Name: CXCL16

Species: Rat

Peptide Sequence
NQGSVAGSCYCDRTIPSGTQIPPATLNHMRKYLKTFHRCQFFIRFQLQSKSVCGGSQDQWVRELVNCFEHKQCGIGHGQS
FHHQKHVPQASTRIPEATEGKPPDTSTAVQFQSTQQSTFPSGAPSLNKELTRHWETTILPSGYGLEARPVAEANEKQHKQ
QKEPGAGAGTQALVPVLSLLAIVFFLVAAMVCVLCNRRVTRQSSSGLQLCYTPVEPRPQGL
Asn-Gln-Gly-Ser-Val-Ala-Gly-Ser-Cys-Tyr-Cys-Asp-Arg-Thr-Ile-Pro-Ser-Gly-Thr-Gln-Ile-Pro-Pro-Ala-Thr-Leu-Asn-His-Met-Arg-Lys-Tyr-Leu-Lys-Thr-Phe-His-Arg-Cys-Gln-Phe-Phe-Ile-Arg-Phe-Gln-Leu-Gln-Ser-Lys-Ser-Val-Cys-Gly-Gly-Ser-Gln-Asp-Gln-Trp-Val-Arg-Glu-Leu-Val-Asn-Cys-Phe-Glu-His-Lys-Gln-Cys-Gly-Ile-Gly-His-Gly-Gln-Ser-Phe-His-His-Gln-Lys-His-Val-Pro-Gln-Ala-Ser-Thr-Arg-Ile-Pro-Glu-Ala-Thr-Glu-Gly-Lys-Pro-Pro-Asp-Thr-Ser-Thr-Ala-Val-Gln-Phe-Gln-Ser-Thr-Gln-Gln-Ser-Thr-Phe-Pro-Ser-Gly-Ala-Pro-Ser-Leu-Asn-Lys-Glu-Leu-Thr-Arg-His-Trp-Glu-Thr-Thr-Ile-Leu-Pro-Ser-Gly-Tyr-Gly-Leu-Glu-Ala-Arg-Pro-Val-Ala-Glu-Ala-Asn-Glu-Lys-Gln-His-Lys-Gln-Gln-Lys-Glu-Pro-Gly-Ala-Gly-Ala-Gly-Thr-Gln-Ala-Leu-Val-Pro-Val-Leu-Ser-Leu-Leu-Ala-Ile-Val-Phe-Phe-Leu-Val-Ala-Ala-Met-Val-Cys-Val-Leu-Cys-Asn-Arg-Arg-Val-Thr-Arg-Gln-Ser-Ser-Ser-Gly-Leu-Gln-Leu-Cys-Tyr-Thr-Pro-Val-Glu-Pro-Arg-Pro-Gln-Gly-Leu