CXCL11

Ligand id: 4432

Name: CXCL11

Species: Mouse

Peptide Sequence
FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM
Phe-Leu-Met-Phe-Lys-Gln-Gly-Arg-Cys-Leu-Cys-Ile-Gly-Pro-Gly-Met-Lys-Ala-Val-Lys-Met-Ala-Glu-Ile-Glu-Lys-Ala-Ser-Val-Ile-Tyr-Pro-Ser-Asn-Gly-Cys-Asp-Lys-Val-Glu-Val-Ile-Val-Thr-Met-Lys-Ala-His-Lys-Arg-Gln-Arg-Cys-Leu-Asp-Pro-Arg-Ser-Lys-Gln-Ala-Arg-Leu-Ile-Met-Gln-Ala-Ile-Glu-Lys-Lys-Asn-Phe-Leu-Arg-Arg-Gln-Asn-Met