CXCL3

Ligand id: 4427

Name: CXCL3

Species: Rat

Peptide Sequence
RELRCQCLKTLPRVDFENIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQAPRLQKIIQKLLKSDKSS
Arg-Glu-Leu-Arg-Cys-Gln-Cys-Leu-Lys-Thr-Leu-Pro-Arg-Val-Asp-Phe-Glu-Asn-Ile-Gln-Ser-Leu-Thr-Val-Thr-Pro-Pro-Gly-Pro-His-Cys-Thr-Gln-Thr-Glu-Val-Ile-Ala-Thr-Leu-Lys-Asp-Gly-Gln-Glu-Val-Cys-Leu-Asn-Pro-Gln-Ala-Pro-Arg-Leu-Gln-Lys-Ile-Ile-Gln-Lys-Leu-Leu-Lys-Ser-Asp-Lys-Ser-Ser