CXCL2

Ligand id: 4425

Name: CXCL2

Species: Rat

Peptide Sequence
SELRCQCLTTLPRVDFKNIQSLTVTPPGPHCAQTEVIATLKDGHEVCLNPEAPLVQRIVQKILNKGKAN
Ser-Glu-Leu-Arg-Cys-Gln-Cys-Leu-Thr-Thr-Leu-Pro-Arg-Val-Asp-Phe-Lys-Asn-Ile-Gln-Ser-Leu-Thr-Val-Thr-Pro-Pro-Gly-Pro-His-Cys-Ala-Gln-Thr-Glu-Val-Ile-Ala-Thr-Leu-Lys-Asp-Gly-His-Glu-Val-Cys-Leu-Asn-Pro-Glu-Ala-Pro-Leu-Val-Gln-Arg-Ile-Val-Gln-Lys-Ile-Leu-Asn-Lys-Gly-Lys-Ala-Asn