GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

PHI   Click here for help

GtoPdb Ligand ID: 4397

Synonyms: intestinal peptide PHI-27 | peptide histidine isoleucine | PHI-27
Compound class: Endogenous peptide in human, mouse or rat
Comment: The rat and mouse PHI sequences are identical
Species: Mouse, Rat
Peptide Sequence Click here for help
HADGVFTSDYSRLLGQISAKKYLESLIGKRISSSISEDPVPI
His-Ala-Asp-Gly-Val-Phe-Thr-Ser-Asp-Tyr-Ser-Arg-Leu-Leu-Gly-Gln-Ile-Ser-Ala-Lys-Lys-Tyr-Leu-Glu-Ser-Leu-Ile-Gly-Lys-Arg-Ile-Ser-Ser-Ser-Ile-Ser-Glu-Asp-Pro-Val-Pro-Ile