PTHrP

Ligand id: 3738

Name: PTHrP

Species: Human

Peptide Sequence
AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKE
QPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSRRH
Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-Glu-Ile-Arg-Ala-Thr-Ser-Glu-Val-Ser-Pro-Asn-Ser-Lys-Pro-Ser-Pro-Asn-Thr-Lys-Asn-His-Pro-Val-Arg-Phe-Gly-Ser-Asp-Asp-Glu-Gly-Arg-Tyr-Leu-Thr-Gln-Glu-Thr-Asn-Lys-Val-Glu-Thr-Tyr-Lys-Glu-Gln-Pro-Leu-Lys-Thr-Pro-Gly-Lys-Lys-Lys-Lys-Gly-Lys-Pro-Gly-Lys-Arg-Lys-Glu-Gln-Glu-Lys-Lys-Lys-Arg-Arg-Thr-Arg-Ser-Ala-Trp-Leu-Asp-Ser-Gly-Val-Thr-Gly-Ser-Gly-Leu-Glu-Gly-Asp-His-Leu-Ser-Asp-Thr-Ser-Thr-Thr-Ser-Leu-Glu-Leu-Asp-Ser-Arg-Arg-His