GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

FSH β subunit   Click here for help

GtoPdb Ligand ID: 3733

Synonyms: follitropin beta subunit | FSH beta subunit | FSHβ | FSH-B
Species: Human
Is a component of
Peptide Sequence Click here for help
NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVAT
QCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
Asn-Ser-Cys-Glu-Leu-Thr-Asn-Ile-Thr-Ile-Ala-Ile-Glu-Lys-Glu-Glu-Cys-Arg-Phe-Cys-Ile-Ser-Ile-Asn-Thr-Thr-Trp-Cys-Ala-Gly-Tyr-Cys-Tyr-Thr-Arg-Asp-Leu-Val-Tyr-Lys-Asp-Pro-Ala-Arg-Pro-Lys-Ile-Gln-Lys-Thr-Cys-Thr-Phe-Lys-Glu-Leu-Val-Tyr-Glu-Thr-Val-Arg-Val-Pro-Gly-Cys-Ala-His-His-Ala-Asp-Ser-Leu-Tyr-Thr-Tyr-Pro-Val-Ala-Thr-Gln-Cys-His-Cys-Gly-Lys-Cys-Asp-Ser-Asp-Ser-Thr-Asp-Cys-Thr-Val-Arg-Gly-Leu-Gly-Pro-Ser-Tyr-Cys-Ser-Phe-Gly-Glu-Met-Lys-Glu
Post-translational Modification
The production of biologically active FSH requires appropriately folded and glycosylated FSHβ and common α subunits that assemble to form the heterodimeric hormone. FSHβ is glysolyated at asparagines 7 and 24, while the common α subunit is glycosylated at asparagines 52 and 78. They then assemble to form the biologically active FSH heterodimer [1].