β-endorphin   

GtoPdb Ligand ID: 3722

Synonyms: β-end
Species: Mouse
Peptide Sequence
YGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ
Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-His-Lys-Lys-Gly-Gln