neuropeptide W-30

Ligand id: 3620

Name: neuropeptide W-30

Abbreviated name: NPW-30

Species: Rat

Peptide Sequence
WYKHVASPRYHTVGRASGLLMGLRRSPYLW
Trp-Tyr-Lys-His-Val-Ala-Ser-Pro-Arg-Tyr-His-Thr-Val-Gly-Arg-Ala-Ser-Gly-Leu-Leu-Met-Gly-Leu-Arg-Arg-Ser-Pro-Tyr-Leu-Trp
Post-translational Modification
None.