GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

gastrin-71   Click here for help

GtoPdb Ligand ID: 3566

Comment: Sulfated form of gastrin-71.
Species: Human
Peptide Sequence Click here for help
SWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF
Ser-Trp-Lys-Pro-Arg-Ser-Gln-Gln-Pro-Asp-Ala-Pro-Leu-Gly-Thr-Gly-Ala-Asn-Arg-Asp-Leu-Glu-Leu-Pro-Trp-Leu-Glu-Gln-Gln-Gly-Pro-Ala-Ser-His-His-Arg-Arg-Gln-Leu-Gly-Pro-Gln-Gly-Pro-Pro-His-Leu-Val-Ala-Asp-Pro-Ser-Lys-Lys-Gln-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tys-Gly-Trp-Met-Asp-Phe-NH2
Post-translational Modification
The tyrosine residue at position 66 is sulfated by tyrosyl-protein sulfotransferase, as indicated by Tys, and the C-terminal phenylalanine is amidated.