PYY-(3-36)   

GtoPdb Ligand ID: 1554

Synonyms: peptide tyrosine tyrosine (3-36) | peptide YY (3-36) | PYY (3-36) | PYY3-36
Species: Mouse, Rat
Peptide Sequence
AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY
Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
Post-translational Modification
The C-terminal tyrosine is amidated.